"CSF2RA" Related Products

Expand
Expand
Expand

Recombinant Human CSF2RA

Cat.No.: CSF2RA-27475TH
Product Overview: Recombinant full length extracellular domain of human GM-CSF Receptor alpha, fused to the Fc region of human IgG1 expressed in modified human 293 cells.
Description: The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble.
Biological activity: CSF2RA-27475TH bound to protein A sepharose beads was able to pull down its ligand, GM-CSF.
Form: Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity: >95% by SDS-PAGE
Storage buffer: Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage: Store at +4°C.
Sequences of amino acids: Theoretical Sequence: EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKC FLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHV NTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNC TWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGT HVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQ YQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRA KHSVKIRAADVRILNWSSWSEAIEFGSDDGGSSNTKVD KKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK
Gene Name: CSF2RA colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) [ Homo sapiens ]
Official Symbol: CSF2RA
Synonyms: CSF2RA; colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage); CSF2R; granulocyte-macrophage colony-stimulating factor receptor subunit alpha; CD116;
Gene ID: 1438
mRNA Refseq: NM_001161529
Protein Refseq: NP_001155001
MIM: 306250
Uniprot ID: P15509
Chromosome Location: Xp22.32 and Yp11.3
Pathway: Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem;
Function: cytokine receptor activity; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.