Recombinant Human CSF2RA CSF2RA-27475TH

Recombinant Human CSF2RA

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human CSF2RA

Recombinant Human CSF2RA

CSF2RA Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : CSF2RA-27475TH
Product Overview : Recombinant full length extracellular domain of human GM-CSF Receptor alpha, fused to the Fc region of human IgG1 expressed in modified human 293 cells.
Description : The protein encoded by this gene is the alpha subunit of the heterodimeric receptor for colony stimulating factor 2, a cytokine which controls the production, differentiation, and function of granulocytes and macrophages. The encoded protein is a member of the cytokine family of receptors. This gene is found in the pseudoautosomal region (PAR) of the X and Y chromosomes. Multiple transcript variants encoding different isoforms have been found for this gene, with some of the isoforms being membrane-bound and others being soluble.
Biological activity : CSF2RA-27475TH bound to protein A sepharose beads was able to pull down its ligand, GM-CSF.
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage : Store at +4°C.
Sequences of amino acids : Theoretical Sequence: EKSDLRTVAPASSLNVRFDSRTMNLSWDCQENTTFSKC FLTDKKNRVVEPRLSNNECSCTFREICLHEGVTFEVHV NTSQRGFQQKLLYPNSGREGTAAQNFSCFIYNADLMNC TWARGPTAPRDVQYFLYIRNSKRRREIRCPYYIQDSGT HVGCHLDNLSGLTSRNYFLVNGTSREIGIQFFDSLLDTKKIERFNPPSNVTVRCNTTHCLVRWKQPRTYQKLSYLDFQ YQLDVHRKNTQPGTENLLINVSGDLENRYNFPSSEPRA KHSVKIRAADVRILNWSSWSEAIEFGSDDGGSSNTKVD KKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK
Gene Name : CSF2RA colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage) [ Homo sapiens ]
Official Symbol : CSF2RA
Synonyms : CSF2RA; colony stimulating factor 2 receptor, alpha, low-affinity (granulocyte-macrophage); CSF2R; granulocyte-macrophage colony-stimulating factor receptor subunit alpha; CD116;
Gene ID : 1438
mRNA Refseq : NM_001161529
Protein Refseq : NP_001155001
MIM : 306250
Uniprot ID : P15509
Chromosome Location : Xp22.32 and Yp11.3
Pathway : Cytokine Signaling in Immune system, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem;
Function : cytokine receptor activity; receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy