"CSRP2" Related Products

Expand
Expand

Recombinant Human CSRP2, His-tagged

Cat.No.: CSRP2-26304TH
Product Overview: Recombinant full length protein, corresponding to amino acids 1-193 of Human CSRP2, with N terminal His tag, 193aa, MWt 26kDa ,
Description: CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation.CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth.Other genes in the family include CSRP1 and CSRP3.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitution with 164 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVC RKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAG TLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGA EKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLE STTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
Gene Name: CSRP2 cysteine and glycine-rich protein 2 [ Homo sapiens ]
Official Symbol: CSRP2
Synonyms: CSRP2; cysteine and glycine-rich protein 2; CRP2; LMO5; SmLIM;
Gene ID: 1466
mRNA Refseq: NM_001321
Protein Refseq: NP_001312
MIM: 601871
Uniprot ID: Q16527
Chromosome Location: 12q21.1
Pathway: ATF-2 transcription factor network, organism-specific biosystem;
Function: metal ion binding; molecular_function; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.