Recombinant Human CSRP2, His-tagged
| Cat.No. : | CSRP2-26304TH |
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-193 of Human CSRP2, with N terminal His tag, 193aa, MWt 26kDa , |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-193 a.a. |
| Description : | CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation.CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth.Other genes in the family include CSRP1 and CSRP3. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitution with 164 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVC RKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAG TLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGA EKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLE STTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ |
| Full Length : | Full L. |
| Gene Name | CSRP2 cysteine and glycine-rich protein 2 [ Homo sapiens ] |
| Official Symbol | CSRP2 |
| Synonyms | CSRP2; cysteine and glycine-rich protein 2; CRP2; LMO5; SmLIM; |
| Gene ID | 1466 |
| mRNA Refseq | NM_001321 |
| Protein Refseq | NP_001312 |
| MIM | 601871 |
| Uniprot ID | Q16527 |
| Chromosome Location | 12q21.1 |
| Pathway | ATF-2 transcription factor network, organism-specific biosystem; |
| Function | metal ion binding; molecular_function; zinc ion binding; |
| ◆ Recombinant Proteins | ||
| CSRP2-2019H | Recombinant Human CSRP2 Protein, GST-tagged | +Inquiry |
| CSRP2-5233H | Recombinant Human CSRP2 protein, His-tagged | +Inquiry |
| CSRP2-6761C | Recombinant Chicken CSRP2 | +Inquiry |
| CSRP2-3991M | Recombinant Mouse CSRP2 Protein | +Inquiry |
| CSRP2-11140Z | Recombinant Zebrafish CSRP2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CSRP2-7232HCL | Recombinant Human CSRP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CSRP2 Products
Required fields are marked with *
My Review for All CSRP2 Products
Required fields are marked with *
