Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human CSRP2, His-tagged

Cat.No. : CSRP2-26304TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-193 of Human CSRP2, with N terminal His tag, 193aa, MWt 26kDa ,
  • Specification
  • Gene Information
  • Related Products
Description : CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation.CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth.Other genes in the family include CSRP1 and CSRP3.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitution with 164 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVC RKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAG TLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGA EKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLE STTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ
Gene Name : CSRP2 cysteine and glycine-rich protein 2 [ Homo sapiens ]
Official Symbol : CSRP2
Synonyms : CSRP2; cysteine and glycine-rich protein 2; CRP2; LMO5; SmLIM;
Gene ID : 1466
mRNA Refseq : NM_001321
Protein Refseq : NP_001312
MIM : 601871
Uniprot ID : Q16527
Chromosome Location : 12q21.1
Pathway : ATF-2 transcription factor network, organism-specific biosystem;
Function : metal ion binding; molecular_function; zinc ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All CSRP2 Products

Required fields are marked with *

My Review for All CSRP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends