Recombinant Human CSRP2, His-tagged
Cat.No. : | CSRP2-26304TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-193 of Human CSRP2, with N terminal His tag, 193aa, MWt 26kDa , |
- Specification
- Gene Information
- Related Products
Description : | CSRP2 is a member of the CSRP family of genes, encoding a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation.CRP2 contains two copies of the cysteine-rich amino acid sequence motif (LIM) with putative zinc-binding activity, and may be involved in regulating ordered cell growth.Other genes in the family include CSRP1 and CSRP3. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitution with 164 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MPVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVC RKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAG TLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGA EKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLE STTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ |
Gene Name : | CSRP2 cysteine and glycine-rich protein 2 [ Homo sapiens ] |
Official Symbol : | CSRP2 |
Synonyms : | CSRP2; cysteine and glycine-rich protein 2; CRP2; LMO5; SmLIM; |
Gene ID : | 1466 |
mRNA Refseq : | NM_001321 |
Protein Refseq : | NP_001312 |
MIM : | 601871 |
Uniprot ID : | Q16527 |
Chromosome Location : | 12q21.1 |
Pathway : | ATF-2 transcription factor network, organism-specific biosystem; |
Function : | metal ion binding; molecular_function; zinc ion binding; |
Products Types
◆ Recombinant Protein | ||
CSRP2-2031M | Recombinant Mouse CSRP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSRP2-675H | Recombinant Human CSRP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CSRP2-2019H | Recombinant Human CSRP2 Protein, GST-tagged | +Inquiry |
Csrp2-2344M | Recombinant Mouse Csrp2 Protein, Myc/DDK-tagged | +Inquiry |
CSRP2-11140Z | Recombinant Zebrafish CSRP2 | +Inquiry |
◆ Lysates | ||
CSRP2-7232HCL | Recombinant Human CSRP2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All CSRP2 Products
Required fields are marked with *
My Review for All CSRP2 Products
Required fields are marked with *
0
Inquiry Basket