"CTSE" Related Products

Expand
Expand

Recombinant Human CTSE

Cat.No.: CTSE-26489TH
Product Overview: Recombinant full length mature Human Cathepsin E, isoform 1 with N terminal propretary tag, 67.8kDa.
Description: The protein encoded by this gene is a gastric aspartyl protease that functions as a disulfide-linked homodimer. This protease, which is a member of the peptidase C1 family, has a specificity similar to that of pepsin A and cathepsin D. It is an intracellular proteinase that does not appear to be involved in the digestion of dietary protein and is found in highest concentration in the surface of epithelial mucus-producing cells of the stomach. It is the first aspartic proteinase expressed in the fetal stomach and is found in more than half of gastric cancers. It appears, therefore, to be an oncofetal antigen. Transcript variants utilizing alternative polyadenylation signals and two transcript variants encoding different isoforms exist for this gene.
Protein length: 379 amino acids
Molecular Weight: 67.800kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Expressed abundantly in the stomach, the Clara cells of the lung and activated B-lymphocytes, and at lower levels in lymph nodes, skin and spleen. Not expressed in resting B-lymphocytes.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: QGSLHRVPLRRHPTLKKKLRARSQLSEFWKSHNLDMIQFT ESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDT GSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSI QYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTLV DAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSV YMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQ IALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQL QNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPT AYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQ FYSVFDRGNNRVGLAPAVP
Sequence Similarities: Belongs to the peptidase A1 family.
Gene Name: CTSE cathepsin E [ Homo sapiens ]
Official Symbol: CTSE
Synonyms: CTSE; cathepsin E;
Gene ID: 1510
mRNA Refseq: NM_001910
Protein Refseq: NP_001901
MIM: 116890
Uniprot ID: P14091
Chromosome Location: 1q32.1
Pathway: Lysosome, organism-specific biosystem; Lysosome, conserved biosystem;
Function: aspartic-type endopeptidase activity; peptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.