Species : |
Human |
Source : |
Wheat Germ |
Tag : |
Non |
Protein Length : |
379 amino acids |
Description : |
The protein encoded by this gene is a gastric aspartyl protease that functions as a disulfide-linked homodimer. This protease, which is a member of the peptidase C1 family, has a specificity similar to that of pepsin A and cathepsin D. It is an intracellular proteinase that does not appear to be involved in the digestion of dietary protein and is found in highest concentration in the surface of epithelial mucus-producing cells of the stomach. It is the first aspartic proteinase expressed in the fetal stomach and is found in more than half of gastric cancers. It appears, therefore, to be an oncofetal antigen. Transcript variants utilizing alternative polyadenylation signals and two transcript variants encoding different isoforms exist for this gene. |
Molecular Weight : |
67.800kDa inclusive of tags |
Tissue specificity : |
Expressed abundantly in the stomach, the Clara cells of the lung and activated B-lymphocytes, and at lower levels in lymph nodes, skin and spleen. Not expressed in resting B-lymphocytes. |
Form : |
Liquid |
Purity : |
Proprietary Purification |
Storage buffer : |
pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : |
QGSLHRVPLRRHPTLKKKLRARSQLSEFWKSHNLDMIQFT ESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDT GSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSI QYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTLV DAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSV YMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQ IALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQL QNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPT AYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQ FYSVFDRGNNRVGLAPAVP |
Sequence Similarities : |
Belongs to the peptidase A1 family. |