Recombinant Full Length Human CTSE Protein, GST-tagged
Cat.No. : | CTSE-2343HF |
Product Overview : | Human CTSE full-length ORF ( AAH42537, 18 a.a. - 396 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 396 amino acids |
Description : | This gene encodes a member of the A1 family of peptidases. Alternative splicing of this gene results in multiple transcript variants. At least one of these variants encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This enzyme, an aspartic endopeptidase, may be involved in antigen processing and the maturation of secretory proteins. Elevated expression of this gene has been observed in neurodegeneration. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 67.43 kDa |
AA Sequence : | QGSLHRVPLRRHPTLKKKLRARSQLSEFWKSHNLDMIQFTESCSMDQSAKEPLINYLDMEYFGTISIGSPPQNFTVIFDTGSSNLWVPSVYCTSPACKTHSRFQPSQSSTYSQPGQSFSIQYGTGSLSGIIGADQVSVEGLTVVGQQFGESVTEPGQTLVDAEFDGILGLGYPSLAVGGVTPVFDNMMAQNLVDLPMFSVYMSSNPEGGAGSELIFGGYDHSHFSGSLNWVPVTKQAYWQIALDNIQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQLQNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPYTLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPLWILGDVFIRQFYSVFDRGNNRVGLAPAVP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CTSE cathepsin E [ Homo sapiens ] |
Official Symbol | CTSE |
Synonyms | CTSE; cathepsin E; slow-moving proteinase; erythrocyte membrane aspartic proteinase; CATE; |
Gene ID | 1510 |
mRNA Refseq | NM_001910 |
Protein Refseq | NP_001901 |
MIM | 116890 |
UniProt ID | P14091 |
◆ Recombinant Proteins | ||
CTSE-2753H | Recombinant Human CTSE Protein, His (Fc)-Avi-tagged | +Inquiry |
CTSE-5090H | Recombinant Human CTSE, His-tagged | +Inquiry |
CTSE-11685H | Recombinant Human CTSE, GST-tagged | +Inquiry |
Ctse-1150R | Recombinant Rat Ctse Protein, His-tagged | +Inquiry |
CTSE-489H | Recombinant Human cathepsin E, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTSE-2190MCL | Recombinant Mouse CTSE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CTSE Products
Required fields are marked with *
My Review for All CTSE Products
Required fields are marked with *
0
Inquiry Basket