"NRN1" Related Products

Expand

Recombinant Human NRN1 protein

Cat.No. : NRN1-1551H
Product Overview : Recombinant Human NRN1 protein was expressed in Escherichia coli.
Description : This gene encodes a member of the neuritin family, and is expressed in postmitotic-differentiating neurons of the developmental nervous system and neuronal structures associated with plasticity in the adult. The expression of this gene can be induced by neural activity and neurotrophins. The encoded protein contains a consensus cleavage signal found in glycosylphoshatidylinositol (GPI)-anchored proteins. The encoded protein promotes neurite outgrowth and arborization, suggesting its role in promoting neuritogenesis. Overexpression of the encoded protein may be associated with astrocytoma progression. Alternative splicing results in multiple transcript variants.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by by a cell proliferation assay using rat C6 cells is less than 25 ng/ml, corresponding to a specific activity of > 4.0 × 104 IU/mg.
Molecular Mass : Approximately 19.4 kDa, a disulfide-linked homodimeric protein containing two 88 amino acids.
Protein length : 88
AA Sequence : AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGN
Endotoxin : Less than 0.1 EU/µg of rHuNeuritin as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : NRN1
Official Symbol : NRN1
Synonyms : NRN1; neuritin 1; neuritin; NRN; dJ380B8.2; MGC44811;
Gene ID : 51299
mRNA Refseq : NM_016588
Protein Refseq : NP_057672
MIM : 607409
UniProt ID : Q9NPD7

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.