Recombinant Human NRN1 protein

Cat.No. : NRN1-1551H
Product Overview : Recombinant Human NRN1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 88
Description : This gene encodes a member of the neuritin family, and is expressed in postmitotic-differentiating neurons of the developmental nervous system and neuronal structures associated with plasticity in the adult. The expression of this gene can be induced by neural activity and neurotrophins. The encoded protein contains a consensus cleavage signal found in glycosylphoshatidylinositol (GPI)-anchored proteins. The encoded protein promotes neurite outgrowth and arborization, suggesting its role in promoting neuritogenesis. Overexpression of the encoded protein may be associated with astrocytoma progression. Alternative splicing results in multiple transcript variants.
Form : Lyophilized from a 0.2μm filtered solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by by a cell proliferation assay using rat C6 cells is less than 25 ng/ml, corresponding to a specific activity of > 4.0 × 10⁴ IU/mg.
Molecular Mass : Approximately 19.4 kDa, a disulfide-linked homodimeric protein containing two 88 amino acids.
AA Sequence : AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGN
Endotoxin : Less than 0.1 EU/µg of rHuNeuritin as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name NRN1
Official Symbol NRN1
Synonyms NRN1; neuritin 1; neuritin; NRN; dJ380B8.2; MGC44811;
Gene ID 51299
mRNA Refseq NM_016588
Protein Refseq NP_057672
MIM 607409
UniProt ID Q9NPD7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NRN1 Products

Required fields are marked with *

My Review for All NRN1 Products

Required fields are marked with *

0
cart-icon