Recombinant Human CXCR3

Cat.No. : CXCR3-26725TH
Product Overview : Recombinant fragment corresponding to amino acids 1-53 of Human CXCR3 with a proprietary tag; Predicted MWt 31.46.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 53 amino acids
Description : This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed CXCL9/Mig (monokine induced by interferon-g), CXCL10/IP10 (interferon-g-inducible 10 kDa protein) and CXCL11/I-TAC (interferon-inducible T cell a-chemoattractant). Binding of chemokines to this protein induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms (CXCR3-B) shows high affinity binding to chemokine, CXCL4/PF4 (PMID:12782716).
Molecular Weight : 31.460kDa inclusive of tags
Tissue specificity : Isoform 1 and isoform 2 are mainly expressed in heart, kidney, liver and skeletal muscle. Isoform 1 is also expressed in placenta.
Biological activity : useful for Antibody Production and Protein Array
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR
Sequence Similarities : Belongs to the G-protein coupled receptor 1 family.
Gene Name CXCR3 chemokine (C-X-C motif) receptor 3 [ Homo sapiens ]
Official Symbol CXCR3
Synonyms CXCR3; chemokine (C-X-C motif) receptor 3; G protein coupled receptor 9 , GPR9; C-X-C chemokine receptor type 3; CD183; CKR L2; CMKAR3; IP10 R; MigR;
Gene ID 2833
mRNA Refseq NM_001142797
Protein Refseq NP_001136269
MIM 300574
Uniprot ID P49682
Chromosome Location Xq13
Pathway CXCR3-mediated signaling events, organism-specific biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem;
Function C-X-C chemokine receptor activity; G-protein coupled receptor activity; chemokine binding; chemokine receptor activity; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCR3 Products

Required fields are marked with *

My Review for All CXCR3 Products

Required fields are marked with *

0
cart-icon
0
compare icon