Recombinant Human CXCR3

• Cat.No.: CXCR3-26725TH
• Product Overview: Recombinant fragment corresponding to amino acids 1-53 of Human CXCR3 with a proprietary tag; Predicted MWt 31.46.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 53 amino acids
• Description: This gene encodes a G protein-coupled receptor with selectivity for three chemokines, termed CXCL9/Mig (monokine induced by interferon-g), CXCL10/IP10 (interferon-g-inducible 10 kDa protein) and CXCL11/I-TAC (interferon-inducible T cell a-chemoattractant). Binding of chemokines to this protein induces cellular responses that are involved in leukocyte traffic, most notably integrin activation, cytoskeletal changes and chemotactic migration. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. One of the isoforms (CXCR3-B) shows high affinity binding to chemokine, CXCL4/PF4 (PMID:12782716).
• Molecular Weight: 31.460kDa inclusive of tags
• Tissue specificity: Isoform 1 and isoform 2 are mainly expressed in heart, kidney, liver and skeletal muscle. Isoform 1 is also expressed in placenta.
• Biological activity: useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDR
• Sequence Similarities: Belongs to the G-protein coupled receptor 1 family.

Gene Information

• Gene Name: CXCR3 chemokine (C-X-C motif) receptor 3 [ Homo sapiens ]
• Official Symbol: CXCR3
• Synonyms: CXCR3; chemokine (C-X-C motif) receptor 3; G protein coupled receptor 9 , GPR9; C-X-C chemokine receptor type 3; CD183; CKR L2; CMKAR3; IP10 R; MigR
• Gene ID: 2833
• mRNA Refseq: NM_001142797
• Protein Refseq: NP_001136269
• MIM: 300574
• Uniprot ID: P49682
• Chromosome Location: Xq13
• Pathway: CXCR3-mediated signaling events, organism-specific biosystem; Chemokine receptors bind chemokines, organism-specific biosystem; Chemokine signaling pathway, organism-specific biosystem; Chemokine signaling pathway, conserved biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem
• Function: C-X-C chemokine receptor activity; G-protein coupled receptor activity; chemokine binding; chemokine receptor activity; receptor activity