Recombinant Human CYB5A, His-tagged
Cat.No. : | CYB5A-27557TH |
Product Overview : | Recombinant full length Human Cytochrome b5 expressed in Saccharomyces cerevisiae; amino acids 1-98 , 11.3kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a membrane-bound cytochrome that reduces ferric hemoglobin (methemoglobin) to ferrous hemoglobin, which is required for stearyl-CoA-desaturase activity. Defects in this gene are a cause of type IV hereditary methemoglobinemia. Three transcript variants encoding different isoforms have been found for this gene. |
Conjugation : | HIS |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKF LEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFI IGELHPDDRPKLNKPPEP |
Sequence Similarities : | Belongs to the cytochrome b5 family.Contains 1 cytochrome b5 heme-binding domain. |
Gene Name : | CYB5A cytochrome b5 type A (microsomal) [ Homo sapiens ] |
Official Symbol : | CYB5A |
Synonyms : | CYB5A; cytochrome b5 type A (microsomal); CYB5, cytochrome b 5 , cytochrome b5 (microsomal); cytochrome b5; |
Gene ID : | 1528 |
mRNA Refseq : | NM_001190807 |
Protein Refseq : | NP_001177736 |
MIM : | 613218 |
Uniprot ID : | P00167 |
Chromosome Location : | 18q23 |
Pathway : | Metabolism, organism-specific biosystem; Metabolism of vitamins and cofactors, organism-specific biosystem; Metabolism of water-soluble vitamins and cofactors, organism-specific biosystem; Vitamin C (ascorbate) metabolism, organism-specific biosystem; gamma-linolenate biosynthesis II (animals), conserved biosystem; |
Function : | aldo-keto reductase (NADP) activity; cytochrome-c oxidase activity; enzyme binding; heme binding; metal ion binding; |
Products Types
◆ Recombinant Protein | ||
CYB5A-947R | Recombinant Rhesus Macaque CYB5A Protein, His (Fc)-Avi-tagged | +Inquiry |
CYB5A-1359R | Recombinant Rat CYB5A Protein, His (Fc)-Avi-tagged | +Inquiry |
CYB5A-2208H | Recombinant Human CYB5A Protein, GST-tagged | +Inquiry |
CYB5A-694H | Recombinant Human CYB5A Protein, His (Fc)-Avi-tagged | +Inquiry |
CYB5A-001H | Recombinant Human CYB5A Protein, His-tagged | +Inquiry |
◆ Lysates | ||
CYB5A-7146HCL | Recombinant Human CYB5A 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket