Recombinant Human DACH1 DACH1-27091TH

Recombinant Human DACH1

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human DACH1

Recombinant Human DACH1

DACH1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : DACH1-27091TH
Product Overview : Recombinant fragment corresponding to amino acids 596-704 of Human DACH1 with N terminal proprietary tag; Predicted MWt 37.62 kDa inclusive of tag.
Description : This gene encodes a chromatin-associated protein that associates with other DNA-binding transcription factors to regulate gene expression and cell fate determination during development. The protein contains a Ski domain that is highly conserved from Drosophila to human. Expression of this gene is lost in some forms of metastatic cancer, and is correlated with poor prognosis. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length : 109 amino acids
Molecular Weight : 37.620kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Widely expressed. Isoform 2 is found in brain, heart, kidney, liver, leukocytes and spleen. Isoform 3 is found in liver and heart. Isoform 4 is found in spleen.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKK AKRKLQEALEFETKRREQAEQTLKQAASTDSLRVLNDSLT PEIEADRSGGRTDAERTIQDGRLYLKTTV
Sequence Similarities : Belongs to the DACH/dachshund family.
Gene Name : DACH1 dachshund homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol : DACH1
Synonyms : DACH1; dachshund homolog 1 (Drosophila); DACH, dachshund homolog (Drosophila); dachshund homolog 1;
Gene ID : 1602
mRNA Refseq : NM_004392
Protein Refseq : NP_004383
MIM : 603803
Uniprot ID : Q9UI36
Chromosome Location : 13q22
Function : DNA binding; nucleotide binding; protein binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy