Recombinant Human DACH1
Cat.No. : | DACH1-27091TH |
Product Overview : | Recombinant fragment corresponding to amino acids 596-704 of Human DACH1 with N terminal proprietary tag; Predicted MWt 37.62 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a chromatin-associated protein that associates with other DNA-binding transcription factors to regulate gene expression and cell fate determination during development. The protein contains a Ski domain that is highly conserved from Drosophila to human. Expression of this gene is lost in some forms of metastatic cancer, and is correlated with poor prognosis. Multiple transcript variants encoding different isoforms have been found for this gene. |
Protein length : | 109 amino acids |
Molecular Weight : | 37.620kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Widely expressed. Isoform 2 is found in brain, heart, kidney, liver, leukocytes and spleen. Isoform 3 is found in liver and heart. Isoform 4 is found in spleen. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKK AKRKLQEALEFETKRREQAEQTLKQAASTDSLRVLNDSLT PEIEADRSGGRTDAERTIQDGRLYLKTTV |
Sequence Similarities : | Belongs to the DACH/dachshund family. |
Gene Name : | DACH1 dachshund homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol : | DACH1 |
Synonyms : | DACH1; dachshund homolog 1 (Drosophila); DACH, dachshund homolog (Drosophila); dachshund homolog 1; |
Gene ID : | 1602 |
mRNA Refseq : | NM_004392 |
Protein Refseq : | NP_004383 |
MIM : | 603803 |
Uniprot ID : | Q9UI36 |
Chromosome Location : | 13q22 |
Function : | DNA binding; nucleotide binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
DACH1-2319H | Recombinant Human DACH1 Protein, GST-tagged | +Inquiry |
DACH1-4312C | Recombinant Chicken DACH1 | +Inquiry |
◆ Lysates | ||
DACH1-7085HCL | Recombinant Human DACH1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket