Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human DACH1

Cat.No. : DACH1-27091TH
Product Overview : Recombinant fragment corresponding to amino acids 596-704 of Human DACH1 with N terminal proprietary tag; Predicted MWt 37.62 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a chromatin-associated protein that associates with other DNA-binding transcription factors to regulate gene expression and cell fate determination during development. The protein contains a Ski domain that is highly conserved from Drosophila to human. Expression of this gene is lost in some forms of metastatic cancer, and is correlated with poor prognosis. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein length : 109 amino acids
Molecular Weight : 37.620kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Widely expressed. Isoform 2 is found in brain, heart, kidney, liver, leukocytes and spleen. Isoform 3 is found in liver and heart. Isoform 4 is found in spleen.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TELKMDFLRERELRETLEKQLAMEQKNRAIVQKRLKKEKK AKRKLQEALEFETKRREQAEQTLKQAASTDSLRVLNDSLT PEIEADRSGGRTDAERTIQDGRLYLKTTV
Sequence Similarities : Belongs to the DACH/dachshund family.
Gene Name : DACH1 dachshund homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol : DACH1
Synonyms : DACH1; dachshund homolog 1 (Drosophila); DACH, dachshund homolog (Drosophila); dachshund homolog 1;
Gene ID : 1602
mRNA Refseq : NM_004392
Protein Refseq : NP_004383
MIM : 603803
Uniprot ID : Q9UI36
Chromosome Location : 13q22
Function : DNA binding; nucleotide binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends