"DCTN1" Related Products

Expand
Expand

Recombinant Human DCTN1, His-tagged

Cat.No.: DCTN1-27132TH
Product Overview: Recombinant fragment, corresponding to amino acids 22-291 of Human DCTN1 isoform p135 with N terminal His tag. MWt ~31 kDa;
Description: This gene encodes the largest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. Dynactin is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit interacts with dynein intermediate chain by its domains directly binding to dynein and binds to microtubules via a highly conserved glycine-rich cytoskeleton-associated protein (CAP-Gly) domain in its N-terminus. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. Mutations in this gene cause distal hereditary motor neuronopathy type VIIB (HMN7B) which is also known as distal spinal and bulbar muscular atrophy (dSBMA).
Conjugation: HIS
Source: E. coli
Tissue specificity: Brain.
Form: Lyophilised:Reconstitution with 102 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: (Amino acid sequence (Sequence determined by 5 Sequencing))ASTGVAGASSSLGPSGSASAGELSSS EPSTPAQTPLAAPIIPTPVLTSPGAVPPLPSPSKEEEG LRAQVRDLEEKLETLRLKRAEDKAKLKELEKHKIQLEQVQ EWKSKMQEQQADLQRRLKEARKEAKEALEAKERYMEEM ADTADAIEMATLDKEMAEERAESLQQEVEALKERVDEL TTDLEILKAEIEEKGSDGAASSYQLKQLEEQNARLKDA LVRMRDLSSSEKQEHVKLQKLMEKKNQELEVVRQQRERLQ EELSQAESTIDE
Sequence Similarities: Belongs to the dynactin 150 kDa subunit family.Contains 1 CAP-Gly domain.
Gene Name: DCTN1 dynactin 1 [ Homo sapiens ]
Official Symbol: DCTN1
Synonyms: DCTN1; dynactin 1; dynactin 1 (p150, Glued (Drosophila) homolog); dynactin subunit 1; p150 glued homolog (Drosophila);
Gene ID: 1639
mRNA Refseq: NM_001135040
Protein Refseq: NP_001128512
MIM: 601143
Uniprot ID: Q14203
Chromosome Location: 2p13
Pathway: Activation of Chaperones by IRE1alpha, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; G2/M Transition, organism-specific biosystem;
Function: motor activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.