"DDX1" Related Products

Expand
Expand

Recombinant Human DDX1

Cat.No.: DDX1-26545TH
Product Overview: Recombinant full length Human DDX1 with N-terminal proprietary tag. Predicted MW 107.14kDa.
Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin.
Protein length: 740 amino acids
Molecular Weight: 107.140kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highest levels of transcription in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin including the retina, brain, and spinal cord.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGG DVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTT IKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWH GCRATKGLMKGKHYYEVSCHDQGLCRVGWSTMQASLDLGT DKFGFGFGGTGKKSHNKQFDNYGEEFTMHDTIGCYLDIDK GHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKF NFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQT KFLPNAPKALIVEPSRELAEQTLNNIKQFKKYIDNPKLRE LLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLN LSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKR LQVIVCSATLHSFDVKKLSEKIMHFPTWVDLKGEDSVPDT VHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGAN SPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCD NLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLER FKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYN TRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVP VDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQELAALEK EAQTSFLHLGYLPNQLFRTF
Sequence Similarities: Belongs to the DEAD box helicase family. DDX1 subfamily.Contains 1 B30.2/SPRY domain.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.
Gene Name: DDX1 DEAD (Asp-Glu-Ala-Asp) box polypeptide 1 [ Homo sapiens ]
Official Symbol: DDX1
Synonyms: DDX1; DEAD (Asp-Glu-Ala-Asp) box polypeptide 1; DEAD/H (Asp Glu Ala Asp/His) box polypeptide 1; ATP-dependent RNA helicase DDX1; DBP RB;
Gene ID: 1653
mRNA Refseq: NM_004939
Protein Refseq: NP_004930
MIM: 601257
Uniprot ID: Q92499
Chromosome Location: 2p24
Pathway: mRNA processing, organism-specific biosystem;
Function: ATP binding; ATP-dependent helicase activity; DNA binding; DNA/RNA helicase activity; RNA binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.