"DICER1" Related Products

Expand
Expand

Recombinant Human DICER1, His-tagged

Cat.No.: DICER1-28329TH
Product Overview: Recombinant fragment, corresponding to amino acids 1566-1922 of Human Dicer with N terminal His tag; Predicted MWt 42 kDa.
Description: This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Alternative splicing results in multiple transcript variants.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 141 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCP TRENFNSQQKNLSVSCAAASVASSRSSVLKDSEYGCLK IPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNKA YLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKH LYEDPRQHSPGVLTDLRSALVNNTIFASLAVKYDYHKYFK AVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEE KEEDIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYY PMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERT YDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRS LKANQPQVPNS
Sequence Similarities: Belongs to the helicase family. Dicer subfamily.Contains 1 Dicer dsRNA-binding fold domain.Contains 1 DRBM (double-stranded RNA-binding) domain.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.Contains 1 PAZ domain.Contains 2 R
Gene Name: DICER1 dicer 1, ribonuclease type III [ Homo sapiens ]
Official Symbol: DICER1
Synonyms: DICER1; dicer 1, ribonuclease type III; Dicer1, Dcr 1 homolog (Drosophila); endoribonuclease Dicer; Dicer; dicer 1; double stranded RNA specific endoribonuclease; HERNA; K12H4.8 LIKE; KIAA0928;
Gene ID: 23405
mRNA Refseq: NM_001195573
Protein Refseq: NP_001182502
MIM: 606241
Uniprot ID: Q9UPY3
Chromosome Location: 14q32.2
Pathway: MicroRNA (miRNA) Biogenesis, organism-specific biosystem; Regulatory RNA pathways, organism-specific biosystem; mRNA processing, organism-specific biosystem;
Function: ATP binding; ATP-dependent helicase activity; double-stranded RNA binding; endonuclease activity; helicase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.