Recombinant Human DICER1, GST-tagged

Cat.No. : DICER1-4738H
Product Overview : Recombinant Human DICER1(1813 a.a. - 1912 a.a.) fussed with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1813-1912 a.a.
Description : This gene encodes a protein possessing an RNA helicase motif containing a DEXH box in its amino terminus and an RNA motif in the carboxy terminus. The encoded protein functions as a ribonuclease and is required by the RNA interference and small temporal RNA (stRNA) pathways to produce the active small RNA component that represses gene expression. Two transcript variants encoding the sameprotein have been identified for this gene.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : Theoretical MW (kDa):36.74
AA Sequence : ESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEMEPETAKFSPAERTYDGKVRVTVEVVGK GKFKGVGRSYRIAKSAAARRALRSL
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name DICER1 dicer 1, ribonuclease type III [ Homo sapiens ]
Official Symbol DICER1
Synonyms DCR1; MNG1; Dicer; HERNA; RMSE2; Dicer1e; K12H4.8-LIKE; endoribonuclease Dicer; Dicer1, Dcr-1 homolog; dicer 1, double-stranded RNA-specific endoribonuclease; helicase MOI; helicase with RNAse motif
Gene ID 23405
mRNA Refseq NM_177438
Protein Refseq NP_803187
MIM 606241
UniProt ID Q9UPY3
Chromosome Location 14q32.13
Pathway Gene Expression, organism-specific biosystem; MicroRNA (miRNA) biogenesis, organism-specific biosystem; Small interfering RNA (siRNA) biogenesis, organism-specific biosystem
Function ATP binding; deoxyribonuclease I activity; double-stranded RNA binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DICER1 Products

Required fields are marked with *

My Review for All DICER1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon