Recombinant Human DNAL4, His-tagged

Cat.No. : DNAL4-26062TH
Product Overview : Recombinant full length Human Dynein light chain with an N terminal His tag ; predicted mwt: 14.1 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 105 amino acids
Description : DNAL4 is a component of the dynein motor complex (Iwasaki et al.
Conjugation : HIS
Molecular Weight : 14.100kDa inclusive of tags
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
Sequence Similarities : Belongs to the dynein light chain family.
Gene Name DNAL4 dynein, axonemal, light chain 4 [ Homo sapiens ]
Official Symbol DNAL4
Synonyms DNAL4; dynein, axonemal, light chain 4; dynein, axonemal, light 4 , dynein, axonemal, light polypeptide 4; dynein light chain 4, axonemal; dJ327J16; PIG27;
Gene ID 10126
mRNA Refseq NM_005740
Protein Refseq NP_005731
MIM 610565
Uniprot ID O96015
Chromosome Location 22q13.1
Pathway Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; NGF signalling via TRKA from the plasma membrane, organism-specific biosystem; Retrograde neurotrophin signalling, organism-specific biosystem; Signal Transduction, organism-specific biosystem;
Function ATPase activity, coupled; microtubule motor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAL4 Products

Required fields are marked with *

My Review for All DNAL4 Products

Required fields are marked with *

0
cart-icon
0
compare icon