Recombinant Human DNAL4, His-tagged
| Cat.No. : | DNAL4-26062TH |
| Product Overview : | Recombinant full length Human Dynein light chain with an N terminal His tag ; predicted mwt: 14.1 kDa; |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 105 amino acids |
| Description : | DNAL4 is a component of the dynein motor complex (Iwasaki et al. |
| Conjugation : | HIS |
| Molecular Weight : | 14.100kDa inclusive of tags |
| Form : | Liquid |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
| Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS |
| Sequence Similarities : | Belongs to the dynein light chain family. |
| Gene Name | DNAL4 dynein, axonemal, light chain 4 [ Homo sapiens ] |
| Official Symbol | DNAL4 |
| Synonyms | DNAL4; dynein, axonemal, light chain 4; dynein, axonemal, light 4 , dynein, axonemal, light polypeptide 4; dynein light chain 4, axonemal; dJ327J16; PIG27; |
| Gene ID | 10126 |
| mRNA Refseq | NM_005740 |
| Protein Refseq | NP_005731 |
| MIM | 610565 |
| Uniprot ID | O96015 |
| Chromosome Location | 22q13.1 |
| Pathway | Huntingtons disease, organism-specific biosystem; Huntingtons disease, conserved biosystem; NGF signalling via TRKA from the plasma membrane, organism-specific biosystem; Retrograde neurotrophin signalling, organism-specific biosystem; Signal Transduction, organism-specific biosystem; |
| Function | ATPase activity, coupled; microtubule motor activity; |
| ◆ Recombinant Proteins | ||
| DNAL4-563H | Recombinant Human DNAL4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DNAL4-4030HF | Recombinant Full Length Human DNAL4 Protein, GST-tagged | +Inquiry |
| DNAL4-2772H | Recombinant Human DNAL4 Protein, GST-tagged | +Inquiry |
| DNAL4-3060H | Recombinant Human DNAL4, T7-tagged | +Inquiry |
| DNAL4-26062TH | Recombinant Human DNAL4, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DNAL4-6868HCL | Recombinant Human DNAL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAL4 Products
Required fields are marked with *
My Review for All DNAL4 Products
Required fields are marked with *
