Recombinant Human DNAL4 Protein, GST-tagged
Cat.No. : | DNAL4-2772H |
Product Overview : | Human DNAL4 full-length ORF ( AAH02968, 1 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. [provided by RefSeq, Dec 2014] |
Molecular Mass : | 37.29 kDa |
AA Sequence : | MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | DNAL4 dynein, axonemal, light chain 4 [ Homo sapiens ] |
Official Symbol | DNAL4 |
Synonyms | DNAL4; dynein, axonemal, light chain 4; dynein, axonemal, light 4 , dynein, axonemal, light polypeptide 4; dynein light chain 4, axonemal; dJ327J16; PIG27; dynein, axonemal, light 4; proliferation-inducing gene 27; dynein light chain, outer arm 4; proliferation-inducing protein 27; dynein, axonemal, light polypeptide 4; |
Gene ID | 10126 |
mRNA Refseq | NM_005740 |
Protein Refseq | NP_005731 |
MIM | 610565 |
UniProt ID | O96015 |
◆ Recombinant Proteins | ||
Dnal4-2613M | Recombinant Mouse Dnal4 Protein, Myc/DDK-tagged | +Inquiry |
DNAL4-26062TH | Recombinant Human DNAL4, His-tagged | +Inquiry |
DNAL4-3060H | Recombinant Human DNAL4, T7-tagged | +Inquiry |
DNAL4-2772H | Recombinant Human DNAL4 Protein, GST-tagged | +Inquiry |
DNAL4-4030HF | Recombinant Full Length Human DNAL4 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DNAL4-6868HCL | Recombinant Human DNAL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DNAL4 Products
Required fields are marked with *
My Review for All DNAL4 Products
Required fields are marked with *