Recombinant Full Length Human DNAL4 Protein, GST-tagged

Cat.No. : DNAL4-4030HF
Product Overview : Human DNAL4 full-length ORF ( AAH02968, 1 a.a. - 105 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 105 amino acids
Description : This gene encodes an axonemal dynein light chain which functions as a component of the outer dynein arms complex. This complex acts as the molecular motor that provides the force to move cilia in an ATP-dependent manner. The encoded protein is expressed in tissues with motile cilia or flagella and may be involved in the movement of sperm flagella. [provided by RefSeq, Dec 2014]
Molecular Mass : 37.29 kDa
AA Sequence : MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DNAL4 dynein, axonemal, light chain 4 [ Homo sapiens ]
Official Symbol DNAL4
Synonyms DNAL4; dynein, axonemal, light chain 4; dynein, axonemal, light 4 , dynein, axonemal, light polypeptide 4; dynein light chain 4, axonemal; dJ327J16; PIG27; dynein, axonemal, light 4; proliferation-inducing gene 27; dynein light chain, outer arm 4; proliferation-inducing protein 27; dynein, axonemal, light polypeptide 4;
Gene ID 10126
mRNA Refseq NM_005740
Protein Refseq NP_005731
MIM 610565
UniProt ID O96015

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DNAL4 Products

Required fields are marked with *

My Review for All DNAL4 Products

Required fields are marked with *

0
cart-icon