"DOCK1" Related Products

Recombinant Human DOCK1

Cat.No.: DOCK1-26153TH
Product Overview: Recombinant full length Human DOCK1 with N-terminal proprietary tag, 42.79 kDa.
Description: This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis.
Protein length: 152 amino acids
Molecular Weight: 42.790kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Highly expressed in placenta, lung, kidney, pancreas and ovary. Expressed at intermediate level in thymus, testes and colon.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MRIGRQSCKIHNYAINNGLFFKCMISPPSGDVRNDIYVTL VQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGD EAISEYKSVIYYQVKQPRWFETVKVLFTWSFYHMALIMKC SFVTQGNILTSSSARELLQAGRVSPNKVIQGC
Sequence Similarities: Belongs to the DOCK family.Contains 1 DHR-1 (CZH-1) domain.Contains 1 DHR-2 (CZH-2) domain.Contains 1 SH3 domain.
Gene Name: DOCK1 dedicator of cytokinesis 1 [ Homo sapiens ]
Official Symbol: DOCK1
Synonyms: DOCK1; dedicator of cytokinesis 1; dedicator of cyto kinesis 1; dedicator of cytokinesis protein 1; ced5; DOCK180; DOwnstream of CrK;
Gene ID: 1793
mRNA Refseq: NM_001380
Protein Refseq: NP_001371
MIM: 601403
Uniprot ID: Q14185
Chromosome Location: 10q26.13-q26.3
Pathway: Axon guidance, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; DCC mediated attractive signaling, organism-specific biosystem; Developmental Biology, organism-specific biosystem;
Function: GTP binding; GTPase activator activity; GTPase binding; SH3 domain binding; guanyl-nucleotide exchange factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.