Recombinant Human DOCK1

Cat.No. : DOCK1-26153TH
Product Overview : Recombinant full length Human DOCK1 with N-terminal proprietary tag, 42.79 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 152 amino acids
Description : This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis.
Molecular Weight : 42.790kDa inclusive of tags
Tissue specificity : Highly expressed in placenta, lung, kidney, pancreas and ovary. Expressed at intermediate level in thymus, testes and colon.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MRIGRQSCKIHNYAINNGLFFKCMISPPSGDVRNDIYVTL VQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGD EAISEYKSVIYYQVKQPRWFETVKVLFTWSFYHMALIMKC SFVTQGNILTSSSARELLQAGRVSPNKVIQGC
Sequence Similarities : Belongs to the DOCK family.Contains 1 DHR-1 (CZH-1) domain.Contains 1 DHR-2 (CZH-2) domain.Contains 1 SH3 domain.
Gene Name DOCK1 dedicator of cytokinesis 1 [ Homo sapiens ]
Official Symbol DOCK1
Synonyms DOCK1; dedicator of cytokinesis 1; dedicator of cyto kinesis 1; dedicator of cytokinesis protein 1; ced5; DOCK180; DOwnstream of CrK;
Gene ID 1793
mRNA Refseq NM_001380
Protein Refseq NP_001371
MIM 601403
Uniprot ID Q14185
Chromosome Location 10q26.13-q26.3
Pathway Axon guidance, organism-specific biosystem; Bacterial invasion of epithelial cells, organism-specific biosystem; Bacterial invasion of epithelial cells, conserved biosystem; DCC mediated attractive signaling, organism-specific biosystem; Developmental Biology, organism-specific biosystem;
Function GTP binding; GTPase activator activity; GTPase binding; SH3 domain binding; guanyl-nucleotide exchange factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DOCK1 Products

Required fields are marked with *

My Review for All DOCK1 Products

Required fields are marked with *

0
cart-icon
0
compare icon