Recombinant Human DOCK1 Protein, GST-tagged

Cat.No. : DOCK1-2802H
Product Overview : Human DOCK1 full-length ORF ( AAH84559.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the dedicator of cytokinesis protein family. Dedicator of cytokinesis proteins act as guanine nucleotide exchange factors for small Rho family G proteins. The encoded protein regulates the small GTPase Rac, thereby influencing several biological processes, including phagocytosis and cell migration. Overexpression of this gene has also been associated with certain cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]
Molecular Mass : 43.6 kDa
AA Sequence : MRIGRQSCKIHNYAINNGLFFKCMISPPSGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETVKVLFTWSFYHMALIMKCSFVTQGNILTSSSARELLQAGRVSPNKVIQGC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name DOCK1 dedicator of cytokinesis 1 [ Homo sapiens ]
Official Symbol DOCK1
Synonyms DOCK1; dedicator of cytokinesis 1; dedicator of cyto kinesis 1; dedicator of cytokinesis protein 1; ced5; DOCK180; DOwnstream of CrK; dedicator of cyto-kinesis 1; 180 kDa protein downstream of CRK;
Gene ID 1793
mRNA Refseq NM_001380
Protein Refseq NP_001371
MIM 601403
UniProt ID Q14185

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DOCK1 Products

Required fields are marked with *

My Review for All DOCK1 Products

Required fields are marked with *

0
cart-icon