Recombinant Full Length Human DOCK1 Protein, GST-tagged
| Cat.No. : | DOCK1-4068HF |
| Product Overview : | Human DOCK1 full-length ORF ( AAH84559.1, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 152 amino acids |
| Description : | This gene encodes a member of the dedicator of cytokinesis protein family. Dedicator of cytokinesis proteins act as guanine nucleotide exchange factors for small Rho family G proteins. The encoded protein regulates the small GTPase Rac, thereby influencing several biological processes, including phagocytosis and cell migration. Overexpression of this gene has also been associated with certain cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014] |
| Molecular Mass : | 43.6 kDa |
| AA Sequence : | MRIGRQSCKIHNYAINNGLFFKCMISPPSGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETVKVLFTWSFYHMALIMKCSFVTQGNILTSSSARELLQAGRVSPNKVIQGC |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | DOCK1 dedicator of cytokinesis 1 [ Homo sapiens ] |
| Official Symbol | DOCK1 |
| Synonyms | DOCK1; dedicator of cytokinesis 1; dedicator of cyto kinesis 1; dedicator of cytokinesis protein 1; ced5; DOCK180; DOwnstream of CrK; dedicator of cyto-kinesis 1; 180 kDa protein downstream of CRK; |
| Gene ID | 1793 |
| mRNA Refseq | NM_001380 |
| Protein Refseq | NP_001371 |
| MIM | 601403 |
| UniProt ID | Q14185 |
| ◆ Recombinant Proteins | ||
| DOCK1-26153TH | Recombinant Human DOCK1 | +Inquiry |
| DOCK1-2802H | Recombinant Human DOCK1 Protein, GST-tagged | +Inquiry |
| DOCK1-126HF | Recombinant Full Length Human DOCK1 Protein | +Inquiry |
| DOCK1-1980H | Recombinant Human DOCK1 Protein (Arg443-Cys627), N-His tagged | +Inquiry |
| DOCK1-4068HF | Recombinant Full Length Human DOCK1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DOCK1 Products
Required fields are marked with *
My Review for All DOCK1 Products
Required fields are marked with *
