Recombinant Full Length Human DOCK1 Protein

Cat.No. : DOCK1-126HF
Product Overview : Recombinant full length Human DOCK1 with N-terminal proprietary tag, 42.79 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 152 amino acids
Description : This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis.
Form : Liquid
Molecular Mass : 42.790kDa inclusive of tags
AA Sequence : MRIGRQSCKIHNYAINNGLFFKCMISPPSGDVRNDIYVTL VQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGD EAISEYKSVIYYQVKQPRWFETVKVLFTWSFYHMALIMKC SFVTQGNILTSSSARELLQAGRVSPNKVIQGC
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name DOCK1 dedicator of cytokinesis 1 [ Homo sapiens ]
Official Symbol DOCK1
Synonyms DOCK1; dedicator of cytokinesis 1; dedicator of cyto kinesis 1; dedicator of cytokinesis protein 1; ced5; DOCK180; DOwnstream of CrK
Gene ID 1793
mRNA Refseq NM_001380
Protein Refseq NP_001371
MIM 601403
UniProt ID Q14185

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All DOCK1 Products

Required fields are marked with *

My Review for All DOCK1 Products

Required fields are marked with *

0
cart-icon