Recombinant Full Length Human DOCK1 Protein
| Cat.No. : | DOCK1-126HF |
| Product Overview : | Recombinant full length Human DOCK1 with N-terminal proprietary tag, 42.79 kDa. |
- Specification
- Gene Information
- Related Products
| Description : | This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis. |
| Source : | In Vitro Cell Free System |
| Species : | Human |
| Form : | Liquid |
| Molecular Mass : | 42.790kDa inclusive of tags |
| Protein Length : | 152 amino acids |
| AA Sequence : | MRIGRQSCKIHNYAINNGLFFKCMISPPSGDVRNDIYVTL VQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGD EAISEYKSVIYYQVKQPRWFETVKVLFTWSFYHMALIMKC SFVTQGNILTSSSARELLQAGRVSPNKVIQGC |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name : | DOCK1 dedicator of cytokinesis 1 [ Homo sapiens ] |
| Official Symbol : | DOCK1 |
| Synonyms : | DOCK1; dedicator of cytokinesis 1; dedicator of cyto kinesis 1; dedicator of cytokinesis protein 1; ced5; DOCK180; DOwnstream of CrK |
| Gene ID : | 1793 |
| mRNA Refseq : | NM_001380 |
| Protein Refseq : | NP_001371 |
| MIM : | 601403 |
| UniProt ID : | Q14185 |
Products Types
| ◆ Recombinant Protein | ||
| DOCK1-401H | Recombinant Human DOCK1 Protein, His-tagged | +Inquiry |
| DOCK1-2802H | Recombinant Human DOCK1 Protein, GST-tagged | +Inquiry |
| DOCK1-26153TH | Recombinant Human DOCK1 | +Inquiry |
| DOCK1-6085Z | Recombinant Zebrafish DOCK1 | +Inquiry |
| DOCK1-26951TH | Recombinant Human DOCK1 | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket
