Recombinant Full Length Human DOCK1 Protein
Cat.No. : | DOCK1-126HF |
Product Overview : | Recombinant full length Human DOCK1 with N-terminal proprietary tag, 42.79 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 152 amino acids |
Description : | This gene product binds to the SH3 domain of CRK protein. It may regulate cell surface extension and may have a role in the cell surface extension of an engulfing cell around a dying cell during apoptosis. |
Form : | Liquid |
Molecular Mass : | 42.790kDa inclusive of tags |
AA Sequence : | MRIGRQSCKIHNYAINNGLFFKCMISPPSGDVRNDIYVTL VQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGD EAISEYKSVIYYQVKQPRWFETVKVLFTWSFYHMALIMKC SFVTQGNILTSSSARELLQAGRVSPNKVIQGC |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | DOCK1 dedicator of cytokinesis 1 [ Homo sapiens ] |
Official Symbol | DOCK1 |
Synonyms | DOCK1; dedicator of cytokinesis 1; dedicator of cyto kinesis 1; dedicator of cytokinesis protein 1; ced5; DOCK180; DOwnstream of CrK |
Gene ID | 1793 |
mRNA Refseq | NM_001380 |
Protein Refseq | NP_001371 |
MIM | 601403 |
UniProt ID | Q14185 |
◆ Recombinant Proteins | ||
DOCK1-6085Z | Recombinant Zebrafish DOCK1 | +Inquiry |
DOCK1-26153TH | Recombinant Human DOCK1 | +Inquiry |
DOCK1-4068HF | Recombinant Full Length Human DOCK1 Protein, GST-tagged | +Inquiry |
DOCK1-26951TH | Recombinant Human DOCK1 | +Inquiry |
DOCK1-1980H | Recombinant Human DOCK1 Protein (Arg443-Cys627), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DOCK1 Products
Required fields are marked with *
My Review for All DOCK1 Products
Required fields are marked with *
0
Inquiry Basket