"DPYD" Related Products

Expand
Expand

Recombinant Human DPYD

Cat.No.: DPYD-28437TH
Product Overview: Recombinant fragment of Human DPYD with N terminal proprietary tag, 37.73kDa.
Description: The protein encoded by this gene is a pyrimidine catabolic enzyme and the initial and rate-limiting factor in the pathway of uracil and thymidine catabolism. Mutations in this gene result in dihydropyrimidine dehydrogenase deficiency, an error in pyrimidine metabolism associated with thymine-uraciluria and an increased risk of toxicity in cancer patients receiving 5-fluorouracil chemotherapy. Two transcript variants encoding different isoforms have been found for this gene.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Found in most tissues with greatest activity found in liver and peripheral blood mononuclear cells.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKH WKRNPDKNCFNCEKLENNFDDIKHTTLGERGALREAMRCL KCADAPCQKSCPTNLDIKSFITSIANKNYY
Sequence Similarities: Belongs to the dihydropyrimidine dehydrogenase family.Contains 3 4Fe-4S ferredoxin-type domains.
Gene Name: DPYD dihydropyrimidine dehydrogenase [ Homo sapiens ]
Official Symbol: DPYD
Synonyms: DPYD; dihydropyrimidine dehydrogenase; dihydropyrimidine dehydrogenase [NADP+]; DPD;
Gene ID: 1806
mRNA Refseq: NM_000110
Protein Refseq: NP_000101
MIM: 612779
Uniprot ID: Q12882
Chromosome Location: 1p22
Pathway: Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem;
Function: 4 iron, 4 sulfur cluster binding; NADP binding; dihydroorotate oxidase activity; dihydropyrimidine dehydrogenase (NADP+) activity; dihydropyrimidine dehydrogenase (NADP+) activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.