Recombinant Human DPYD

• Cat.No.: DPYD-28437TH
• Product Overview: Recombinant fragment of Human DPYD with N terminal proprietary tag, 37.73kDa.

Specification

• Description: The protein encoded by this gene is a pyrimidine catabolic enzyme and the initial and rate-limiting factor in the pathway of uracil and thymidine catabolism. Mutations in this gene result in dihydropyrimidine dehydrogenase deficiency, an error in pyrimidine metabolism associated with thymine-uraciluria and an increased risk of toxicity in cancer patients receiving 5-fluorouracil chemotherapy. Two transcript variants encoding different isoforms have been found for this gene.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Found in most tissues with greatest activity found in liver and peripheral blood mononuclear cells.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAPVLSKDSADIESILALNPRTQTHATLCSTSAKKLDKKH WKRNPDKNCFNCEKLENNFDDIKHTTLGERGALREAMRCL KCADAPCQKSCPTNLDIKSFITSIANKNYY
• Sequence Similarities: Belongs to the dihydropyrimidine dehydrogenase family.Contains 3 4Fe-4S ferredoxin-type domains.

Gene Information

• Gene Name: DPYD dihydropyrimidine dehydrogenase [ Homo sapiens ]
• Official Symbol: DPYD
• Synonyms: DPYD; dihydropyrimidine dehydrogenase; dihydropyrimidine dehydrogenase [NADP+]; DPD
• Gene ID: 1806
• mRNA Refseq: NM_000110
• Protein Refseq: NP_000101
• MIM: 612779
• Uniprot ID: Q12882
• Chromosome Location: 1p22
• Pathway: Drug metabolism - other enzymes, organism-specific biosystem; Drug metabolism - other enzymes, conserved biosystem; Fluoropyrimidine Activity, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem
• Function: 4 iron, 4 sulfur cluster binding; NADP binding; dihydroorotate oxidase activity; dihydropyrimidine dehydrogenase (NADP+) activity; dihydropyrimidine dehydrogenase (NADP+) activity