Recombinant Human DPYSL4, His-tagged
Cat.No. : | DPYSL4-26938TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 258-561 of Human CRMP3 with a N terminal His tag; predicted MWt 35 kDa: |
- Specification
- Gene Information
- Related Products
Description : | Dihydropyrimidinase-related protein 4 is an enzyme that in humans is encoded by the DPYSL4 gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:reconstitution with 64 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KGAADAIAQAKRRGVVVFGEPITASLGTDGSHYWSKNWAK AAAFVTSPPVNPDPTTADHLTCLLSSGDLQVTGSAHCT FTTAQKAVGKDNFALIPEGTNGIEERMSMVWEKCVASG KMDENEFVAVTSTNAAKIFNFYPRKGRVAVGSDADLVI WNPKATKIISAKTHNLNVEYNIFEGVECRGAPAVVISQGR VALEDGKMFVTPGAGRFVPRKTFPDFVYKRIKARNRLA EIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKIS VPPVRNLHQSGFSLSGSQADDHIARRTAQKIMAP |
Sequence Similarities : | Belongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily. |
Gene Name : | DPYSL4 dihydropyrimidinase-like 4 [ Homo sapiens ] |
Official Symbol : | DPYSL4 |
Synonyms : | DPYSL4; dihydropyrimidinase-like 4; dihydropyrimidinase-related protein 4; DRP 4; ULIP4; |
Gene ID : | 10570 |
mRNA Refseq : | NM_006426 |
Protein Refseq : | NP_006417 |
MIM : | 608407 |
Uniprot ID : | O14531 |
Chromosome Location : | 10q25.2-q26 |
Pathway : | Axon guidance, organism-specific biosystem; CRMPs in Sema3A signaling, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Semaphorin interactions, organism-specific biosystem; |
Function : | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides; |
Products Types
◆ Recombinant Protein | ||
Dpysl4-2653M | Recombinant Mouse Dpysl4 Protein, Myc/DDK-tagged | +Inquiry |
DPYSL4-2531H | Recombinant Human DPYSL4 Protein, MYC/DDK-tagged | +Inquiry |
DPYSL4-789H | Recombinant Human DPYSL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
DPYSL4-2866H | Recombinant Human DPYSL4 Protein, GST-tagged | +Inquiry |
DPYSL4-1275H | Recombinant Human DPYSL4 protein, His & T7-tagged | +Inquiry |
◆ Lysates | ||
DPYSL4-508HCL | Recombinant Human DPYSL4 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DPYSL4 Products
Required fields are marked with *
My Review for All DPYSL4 Products
Required fields are marked with *
0
Inquiry Basket