"DPYSL4" Related Products

Expand
Expand

Recombinant Human DPYSL4, His-tagged

Cat.No.: DPYSL4-26938TH
Product Overview: Recombinant fragment, corresponding to amino acids 258-561 of Human CRMP3 with a N terminal His tag; predicted MWt 35 kDa:
Description: Dihydropyrimidinase-related protein 4 is an enzyme that in humans is encoded by the DPYSL4 gene.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:reconstitution with 64 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KGAADAIAQAKRRGVVVFGEPITASLGTDGSHYWSKNWAK AAAFVTSPPVNPDPTTADHLTCLLSSGDLQVTGSAHCT FTTAQKAVGKDNFALIPEGTNGIEERMSMVWEKCVASG KMDENEFVAVTSTNAAKIFNFYPRKGRVAVGSDADLVI WNPKATKIISAKTHNLNVEYNIFEGVECRGAPAVVISQGR VALEDGKMFVTPGAGRFVPRKTFPDFVYKRIKARNRLA EIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKIS VPPVRNLHQSGFSLSGSQADDHIARRTAQKIMAP
Sequence Similarities: Belongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily.
Gene Name: DPYSL4 dihydropyrimidinase-like 4 [ Homo sapiens ]
Official Symbol: DPYSL4
Synonyms: DPYSL4; dihydropyrimidinase-like 4; dihydropyrimidinase-related protein 4; DRP 4; ULIP4;
Gene ID: 10570
mRNA Refseq: NM_006426
Protein Refseq: NP_006417
MIM: 608407
Uniprot ID: O14531
Chromosome Location: 10q25.2-q26
Pathway: Axon guidance, organism-specific biosystem; CRMPs in Sema3A signaling, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Semaphorin interactions, organism-specific biosystem;
Function: hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.