Recombinant Human DPYSL4, His-tagged
Cat.No. : | DPYSL4-26938TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 258-561 of Human CRMP3 with a N terminal His tag; predicted MWt 35 kDa: |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 258-561 a.a. |
Description : | Dihydropyrimidinase-related protein 4 is an enzyme that in humans is encoded by the DPYSL4 gene. |
Conjugation : | HIS |
Form : | Lyophilised:reconstitution with 64 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | KGAADAIAQAKRRGVVVFGEPITASLGTDGSHYWSKNWAK AAAFVTSPPVNPDPTTADHLTCLLSSGDLQVTGSAHCT FTTAQKAVGKDNFALIPEGTNGIEERMSMVWEKCVASG KMDENEFVAVTSTNAAKIFNFYPRKGRVAVGSDADLVI WNPKATKIISAKTHNLNVEYNIFEGVECRGAPAVVISQGR VALEDGKMFVTPGAGRFVPRKTFPDFVYKRIKARNRLA EIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKIS VPPVRNLHQSGFSLSGSQADDHIARRTAQKIMAP |
Sequence Similarities : | Belongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily. |
Gene Name | DPYSL4 dihydropyrimidinase-like 4 [ Homo sapiens ] |
Official Symbol | DPYSL4 |
Synonyms | DPYSL4; dihydropyrimidinase-like 4; dihydropyrimidinase-related protein 4; DRP 4; ULIP4; |
Gene ID | 10570 |
mRNA Refseq | NM_006426 |
Protein Refseq | NP_006417 |
MIM | 608407 |
Uniprot ID | O14531 |
Chromosome Location | 10q25.2-q26 |
Pathway | Axon guidance, organism-specific biosystem; CRMPs in Sema3A signaling, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Semaphorin interactions, organism-specific biosystem; |
Function | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amides; |
◆ Recombinant Proteins | ||
DPYSL4-4171HF | Recombinant Full Length Human DPYSL4 Protein, GST-tagged | +Inquiry |
DPYSL4-2712Z | Recombinant Zebrafish DPYSL4 | +Inquiry |
Dpysl4-2653M | Recombinant Mouse Dpysl4 Protein, Myc/DDK-tagged | +Inquiry |
DPYSL4-5771C | Recombinant Chicken DPYSL4 | +Inquiry |
DPYSL4-6184H | Recombinant Human DPYSL4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
DPYSL4-508HCL | Recombinant Human DPYSL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPYSL4 Products
Required fields are marked with *
My Review for All DPYSL4 Products
Required fields are marked with *