"DST" Related Products

Expand

Recombinant Human DST

Cat.No.: DST-26933TH
Product Overview: Recombinant fragment of Human Dystonin with N-terminal proprietary tag. Predicted MW 36.63 kDa.
Description: This gene encodes a member of the plakin protein family of adhesion junction plaque proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the full-length nature of some variants has not been defined. It has been reported that some isoforms are expressed in neural and muscle tissue, anchoring neural intermediate filaments to the actin cytoskeleton, and some isoforms are expressed in epithelial tissue, anchoring keratin-containing intermediate filaments to hemidesmosomes. Consistent with the expression, mice defective for this gene show skin blistering and neurodegeneration.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS
Gene Name: DST dystonin [ Homo sapiens ]
Official Symbol: DST
Synonyms: DST; dystonin; BPAG1, bullous pemphigoid antigen 1, 230/240kDa; bullous pemphigoid antigen 1; BP240; BPA; CATX 15; FLJ13425; FLJ21489; FLJ30627; FLJ32235; KIAA0728; MACF2;
Gene ID: 667
mRNA Refseq: NM_001723
Protein Refseq: NP_001714
MIM: 113810
Uniprot ID: Q03001
Chromosome Location: 6p12.1
Pathway: Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Type I hemidesmosome assembly, organism-specific biosystem;
Function: actin binding; calcium ion binding; integrin binding; microtubule plus-end binding; protein C-terminus binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.