Recombinant Human DST Protein, His-SUMO-tagged
Cat.No. : | DST-1196H |
Product Overview : | Recombinant Human DST Protein (1-195aa) was expressed in E. coli with N-terminal 6xHis-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-195 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 39.1 kDa |
AA Sequence : | MHSSSYSYRSSDSVFSNTTSTRTSLDSNENLLLVHCGPTLINSCISFGSESFDGHRLEMLQQIANRVQRD SVICEDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRV AKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | DST dystonin [ Homo sapiens ] |
Official Symbol | DST |
Synonyms | DT; BPA; DMH; BP240; BPAG1; EBSB2; HSAN6; MACF2; CATX15; CATX-15; D6S1101 |
Gene ID | 667 |
mRNA Refseq | NM_001723.5 |
Protein Refseq | NP_001714.1 |
MIM | 113810 |
UniProt ID | Q03001 |
◆ Recombinant Proteins | ||
DST-26933TH | Recombinant Human DST | +Inquiry |
DST-156H | Recombinant Human DST | +Inquiry |
DST-2893H | Recombinant Human DST Protein, GST-tagged | +Inquiry |
DST-301443H | Recombinant Human DST protein, GST-tagged | +Inquiry |
DST-2208H | Recombinant Human DST Protein (Met1-Trp979), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DST Products
Required fields are marked with *
My Review for All DST Products
Required fields are marked with *