Recombinant Human DST
Cat.No. : | DST-26933TH |
Product Overview : | Recombinant fragment of Human Dystonin with N-terminal proprietary tag. Predicted MW 36.63 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes a member of the plakin protein family of adhesion junction plaque proteins. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene, but the full-length nature of some variants has not been defined. It has been reported that some isoforms are expressed in neural and muscle tissue, anchoring neural intermediate filaments to the actin cytoskeleton, and some isoforms are expressed in epithelial tissue, anchoring keratin-containing intermediate filaments to hemidesmosomes. Consistent with the expression, mice defective for this gene show skin blistering and neurodegeneration. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS |
Gene Name | DST dystonin [ Homo sapiens ] |
Official Symbol | DST |
Synonyms | DST; dystonin; BPAG1, bullous pemphigoid antigen 1, 230/240kDa; bullous pemphigoid antigen 1; BP240; BPA; CATX 15; FLJ13425; FLJ21489; FLJ30627; FLJ32235; KIAA0728; MACF2; |
Gene ID | 667 |
mRNA Refseq | NM_001723 |
Protein Refseq | NP_001714 |
MIM | 113810 |
Uniprot ID | Q03001 |
Chromosome Location | 6p12.1 |
Pathway | Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Type I hemidesmosome assembly, organism-specific biosystem; |
Function | actin binding; calcium ion binding; integrin binding; microtubule plus-end binding; protein C-terminus binding; |
◆ Recombinant Proteins | ||
DST-2823H | Recombinant Human DST protein(6011-6580 aa), C-His-tagged | +Inquiry |
DST-1196H | Recombinant Human DST Protein, His-SUMO-tagged | +Inquiry |
DST-156H | Recombinant Human DST | +Inquiry |
DST-2208H | Recombinant Human DST Protein (Met1-Trp979), N-His tagged | +Inquiry |
DST-2893H | Recombinant Human DST Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DST Products
Required fields are marked with *
My Review for All DST Products
Required fields are marked with *