Recombinant Human DST protein, GST-tagged
| Cat.No. : | DST-301443H |
| Product Overview : | Recombinant Human DST (420-610 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Ser420-Asp610 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization |
| AA Sequence : | SGVQFQNEAEIAGYILECENLLRQHVIDVQILIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMISGITQSLNSGFAQTLHPSLTSGLTQSLTPSLTSSSMTSGLSSGMTSRLTPSVTPAYTPGFPSGLVPNFSSGVEPNSLQTLKLMQIRKPLLKSSLLDQNLTEEEINMKFVQD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | DST dystonin [ Homo sapiens ] |
| Official Symbol | DST |
| Synonyms | DST; dystonin; BPAG1, bullous pemphigoid antigen 1, 230/240kDa; bullous pemphigoid antigen 1; BP240; BPA; CATX 15; FLJ13425; FLJ21489; FLJ30627; FLJ32235; KIAA0728; MACF2; trabeculin-beta; dystonia musculorum protein; hemidesmosomal plaque protein; 230/240 kDa bullous pemphigoid antigen; bullous pemphigoid antigen 1, 230/240kDa; DT; DMH; BPAG1; CATX15; CATX-15; D6S1101; FLJ46791; KIAA0465; KIAA1470; DKFZp564B2416; |
| Gene ID | 667 |
| mRNA Refseq | NM_001723 |
| Protein Refseq | NP_001714 |
| MIM | 113810 |
| UniProt ID | Q03001 |
| ◆ Recombinant Proteins | ||
| DST-2823H | Recombinant Human DST protein(6011-6580 aa), C-His-tagged | +Inquiry |
| DST-2208H | Recombinant Human DST Protein (Met1-Trp979), N-His tagged | +Inquiry |
| DST-1693H | Recombinant Human DST Protein (1-195 aa), His-tagged | +Inquiry |
| DST-688H | Recombinant Human DST Protein, His-tagged | +Inquiry |
| DST-301443H | Recombinant Human DST protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DST Products
Required fields are marked with *
My Review for All DST Products
Required fields are marked with *
