"DVL1" Related Products

Expand
Expand

Recombinant Human DVL1

Cat.No.: DVL1-28351TH
Product Overview: Recombinant fragment of Human Dishevelled / Dvl1 with N terminal proprietary tag, 37.73 kDa.
Description: DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.
Protein length: 110 amino acids
Molecular Weight: 37.730kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNR PVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSW LVLAEGAHSDAGSQGTDSHTDLPPPLERTG
Sequence Similarities: Belongs to the DSH family.Contains 1 DEP domain.Contains 1 DIX domain.Contains 1 PDZ (DHR) domain.
Gene Name: DVL1 dishevelled, dsh homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol: DVL1
Synonyms: DVL1; dishevelled, dsh homolog 1 (Drosophila); dishevelled 1 (homologous to Drosophila dsh); segment polarity protein dishevelled homolog DVL-1;
Gene ID: 1855
mRNA Refseq: NM_004421
Protein Refseq: NP_004412
MIM: 601365
Uniprot ID: O14640
Chromosome Location: 1p36
Pathway: Adipogenesis, organism-specific biosystem; Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem;
Function: Rac GTPase binding; Rac GTPase binding; enzyme binding; frizzled binding; identical protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.