"E4F1" Related Products

Expand
Expand

Recombinant Human E4F1, His-tagged

Cat.No.: E4F1-27377TH
Product Overview: Recombinant fragment, corresponding to amino acids 137-588 of Human E4F1 with an N terminal His tag. Predicted MWt: 50 kDa,
Description: The zinc finger protein encoded by this gene is one of several cellular transcription factors whose DNA-binding activities are regulated through the action of adenovirus E1A. A 50-kDa amino-terminal product is generated from the full-length protein through proteolytic cleavage. The protein is differentially regulated by E1A-induced phosphorylation. The full-length gene product represses transcription from the E4 promoter in the absence of E1A, while the 50-kDa form acts as a transcriptional activator in its presence.
Conjugation: HIS
Source: E. coli
Form: Lyophilised:Reconstitute with 87 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: LVGGGHIKEVIVAAEAELGDGEMAEAPGSPRQQGLGLAGE GEQAQVKLLVNKDGRYVCALCHKTFKTGSILKAHMVTH SSRKDHECKLCGASFRTKGSLIRHHRRHTDERPYKCSK CGKSFRESGALTRHLKSLTPCTEKIRFSVSKDVVVSKEDA RAGSGAGAAGLGTATSSVTGEPIETSPVIHLVTDAKGT VIHEVHVQMQELSLGMKALAPEPPVSQELPCSSEGSRE NLLHQAMQNSGIVLERAAGEEGALEPAPAAGSSPQPLA VAAPQLPVLEVQPLETQVASEASAVPRTHPCPQCSETFPT AATLEAHKRGHTGPRPFACAQCGKAFPKAYLLKKHQEV HVRERRFRCGDCGKLYKTIAHVRGHRRVHSDERPYPCP KCGKRYKTKNAQQVHFRTHLEEKPHVCQFCSRGFREKGSLVRHVRHHTGEKPFKCYKCGRGFAEHG
Gene Name: E4F1 E4F transcription factor 1 [ Homo sapiens ]
Official Symbol: E4F1
Synonyms: E4F1; E4F transcription factor 1; transcription factor E4F1; E4F;
Gene ID: 1877
mRNA Refseq: NM_004424
Protein Refseq: NP_004415
MIM: 603022
Uniprot ID: Q66K89
Chromosome Location: 16p13.3
Pathway: p53 pathway, organism-specific biosystem;
Function: DNA binding; cAMP response element binding; ligase activity; metal ion binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.