Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human EEF1E1, His-tagged

Cat.No. : EEF1E1-27130TH
Product Overview : Recombinant full length protein, (amino acids 1-174) of Human AIMP3/p18 with N terminal His tag; 194 amino acids, 21.9 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a multifunctional protein that localizes to both the cytoplasm and nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage, and it plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream MUTED (muted homolog) gene. An EEF1E1-related pseudogene has been identified on chromosome 2.
Protein length : 174 amino acids
Conjugation : HIS
Molecular Weight : 21.900kDa inclusive of tags
Source : E. coli
Tissue specificity : Down-regulated in various cancer tissues.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMAAAAELSLLEKSLGLSKGN KYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYL LGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNS YLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYL NVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Sequence Similarities : Contains 1 GST C-terminal domain.
Gene Name : EEF1E1 eukaryotic translation elongation factor 1 epsilon 1 [ Homo sapiens ]
Official Symbol : EEF1E1
Synonyms : EEF1E1; eukaryotic translation elongation factor 1 epsilon 1; P18; eukaryotic translation elongation factor 1 epsilon-1; AIMP3; aminoacyl tRNA synthetase complex interacting multifunctional protein 3;
Gene ID : 9521
mRNA Refseq : NM_001135650
Protein Refseq : NP_001129122
MIM : 609206
Uniprot ID : O43324
Chromosome Location : 6p24.3
Pathway : Cytosolic tRNA aminoacylation, organism-specific biosystem; Gene Expression, organism-specific biosystem; tRNA Aminoacylation, organism-specific biosystem;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends