Recombinant Human EEF1E1, His-tagged
Cat.No. : | EEF1E1-27130TH |
Product Overview : | Recombinant full length protein, (amino acids 1-174) of Human AIMP3/p18 with N terminal His tag; 194 amino acids, 21.9 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a multifunctional protein that localizes to both the cytoplasm and nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage, and it plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream MUTED (muted homolog) gene. An EEF1E1-related pseudogene has been identified on chromosome 2. |
Protein length : | 174 amino acids |
Conjugation : | HIS |
Molecular Weight : | 21.900kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Down-regulated in various cancer tissues. |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAAAAELSLLEKSLGLSKGN KYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYL LGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNS YLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYL NVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH |
Sequence Similarities : | Contains 1 GST C-terminal domain. |
Gene Name : | EEF1E1 eukaryotic translation elongation factor 1 epsilon 1 [ Homo sapiens ] |
Official Symbol : | EEF1E1 |
Synonyms : | EEF1E1; eukaryotic translation elongation factor 1 epsilon 1; P18; eukaryotic translation elongation factor 1 epsilon-1; AIMP3; aminoacyl tRNA synthetase complex interacting multifunctional protein 3; |
Gene ID : | 9521 |
mRNA Refseq : | NM_001135650 |
Protein Refseq : | NP_001129122 |
MIM : | 609206 |
Uniprot ID : | O43324 |
Chromosome Location : | 6p24.3 |
Pathway : | Cytosolic tRNA aminoacylation, organism-specific biosystem; Gene Expression, organism-specific biosystem; tRNA Aminoacylation, organism-specific biosystem; |
Products Types
◆ Recombinant Protein | ||
EEF1E1-1209R | Recombinant Rhesus Macaque EEF1E1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EEF1E1-131H | Recombinant Human EEF1E1 protein(Met1-His174), His-tagged | +Inquiry |
EEF1E1-2649M | Recombinant Mouse EEF1E1 Protein, His (Fc)-Avi-tagged | +Inquiry |
EEF1E1-3073H | Recombinant Human EEF1E1 Protein, GST-tagged | +Inquiry |
EEF1E1-1384R | Recombinant Rhesus monkey EEF1E1 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
EEF1E1-6713HCL | Recombinant Human EEF1E1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket