Recombinant Full Length Human EEF1E1 Protein, GST-tagged
Cat.No. : | EEF1E1-4209HF |
Product Overview : | Human EEF1E1 full-length ORF ( AAH05291, 1 a.a. - 174 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 174 amino acids |
Description : | This gene encodes a multifunctional protein that localizes to both the cytoplasm and nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage, and it plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream MUTED (muted homolog) gene. An EEF1E1-related pseudogene has been identified on chromosome 2. [provided by RefSeq, Dec 2010] |
Molecular Mass : | 44.88 kDa |
AA Sequence : | MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | EEF1E1 eukaryotic translation elongation factor 1 epsilon 1 [ Homo sapiens ] |
Official Symbol | EEF1E1 |
Synonyms | EEF1E1; eukaryotic translation elongation factor 1 epsilon 1; P18; eukaryotic translation elongation factor 1 epsilon-1; AIMP3; aminoacyl tRNA synthetase complex interacting multifunctional protein 3; ARS-interacting multifunctional protein 3; multisynthase complex auxiliary component p18; p18 component of aminoacyl-tRNA synthetase complex; aminoacyl tRNA synthetase complex-interacting multifunctional protein 3; |
Gene ID | 9521 |
mRNA Refseq | NM_001135650 |
Protein Refseq | NP_001129122 |
MIM | 609206 |
UniProt ID | O43324 |
◆ Recombinant Proteins | ||
EEF1E1-12292H | Recombinant Human EEF1E1 protein, GST-tagged | +Inquiry |
EEF1E1-27130TH | Recombinant Human EEF1E1, His-tagged | +Inquiry |
Eef1e1-1395M | Recombinant Mouse Eef1e1 protein, His & T7-tagged | +Inquiry |
EEF1E1-1384R | Recombinant Rhesus monkey EEF1E1 Protein, His-tagged | +Inquiry |
EEF1E1-3510H | Recombinant Human EEF1E1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EEF1E1-6713HCL | Recombinant Human EEF1E1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1E1 Products
Required fields are marked with *
My Review for All EEF1E1 Products
Required fields are marked with *