Recombinant Human EEF1E1 protein, His-SUMO-tagged
| Cat.No. : | EEF1E1-2834H |
| Product Overview : | Recombinant Human EEF1E1 protein(O43324)(2-174aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 2-174aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.7 kDa |
| AA Sequence : | AAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | EEF1E1 eukaryotic translation elongation factor 1 epsilon 1 [ Homo sapiens ] |
| Official Symbol | EEF1E1 |
| Synonyms | EEF1E1; eukaryotic translation elongation factor 1 epsilon 1; P18; eukaryotic translation elongation factor 1 epsilon-1; AIMP3; aminoacyl tRNA synthetase complex interacting multifunctional protein 3; ARS-interacting multifunctional protein 3; multisynthase complex auxiliary component p18; p18 component of aminoacyl-tRNA synthetase complex; aminoacyl tRNA synthetase complex-interacting multifunctional protein 3; |
| Gene ID | 9521 |
| mRNA Refseq | NM_001135650 |
| Protein Refseq | NP_001129122 |
| MIM | 609206 |
| UniProt ID | O43324 |
| ◆ Recombinant Proteins | ||
| EEF1E1-131H | Recombinant Human EEF1E1 protein(Met1-His174), His-tagged | +Inquiry |
| EEF1E1-2834H | Recombinant Human EEF1E1 protein, His-SUMO-tagged | +Inquiry |
| EEF1E1-3073H | Recombinant Human EEF1E1 Protein, GST-tagged | +Inquiry |
| EEF1E1-12292H | Recombinant Human EEF1E1 protein, GST-tagged | +Inquiry |
| EEF1E1-4209HF | Recombinant Full Length Human EEF1E1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EEF1E1-6713HCL | Recombinant Human EEF1E1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EEF1E1 Products
Required fields are marked with *
My Review for All EEF1E1 Products
Required fields are marked with *
