"EEF1G" Related Products

Expand
Expand

Recombinant Human EEF1G, His-tagged

Cat.No.: EEF1G-27778TH
Product Overview: Recombinant full length protein, corresponding to amino acids 2-437 of Human EEF1G with N terminal His tag. Predicted MWt 50kDa;
Description: This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit contains an N-terminal glutathione transferase domain, which may be involved in regulating the assembly of multisubunit complexes containing this elongation factor and aminoacyl-tRNA synthetases.
Conjugation: HIS
Source: E. coli
Tissue specificity: Highly expressed in pancreatic tumor tissue and to a lesser extent in normal kidney, intestine, pancreas, stomach, lung, brain, spleen and liver.
Form: Lyophilised:Reconstitute with 113 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: AAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFG QTNRTPEFLRKFPAGKVPAFEGDDGFCVFESNAIAYYV SNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPT LGIMHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERV TLADITVVCTLLWLYKQVLEPSFRQAFPNTNRWFLTCI NQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRK EKGSREEKQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNEDTLSVALPYFW EHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRL DKLRKNAFASVILFGTNNSSSISGVWVFRGQELAFPLS PDWQVDYESYTWRKLDPGSEETQTLVREYFSWEGAFQHVG KAFNQGKIFK
Sequence Similarities: Contains 1 EF-1-gamma C-terminal domain.Contains 1 GST C-terminal domain.Contains 1 GST N-terminal domain.
Gene Name: EEF1G eukaryotic translation elongation factor 1 gamma [ Homo sapiens ]
Official Symbol: EEF1G
Synonyms: EEF1G; eukaryotic translation elongation factor 1 gamma; elongation factor 1-gamma; EF1G;
Gene ID: 1937
mRNA Refseq: NM_001404
Protein Refseq: NP_001395
MIM: 130593
Uniprot ID: P26641
Chromosome Location: 11q12.3
Pathway: Eukaryotic Translation Elongation, organism-specific biosystem; Gene Expression, organism-specific biosystem; Legionellosis, organism-specific biosystem; Legionellosis, conserved biosystem; Metabolism of proteins, organism-specific biosystem;
Function: protein binding; translation elongation factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.