Recombinant Human EFNA1, His-tagged

Cat.No. : EFNA1-28470TH
Product Overview : Recombinant full length Human Ephrin A1 with an N terminal His tag; 185 amino acids with tag, Predicted MWt 21.6 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 164 amino acids
Description : This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis.
Conjugation : HIS
Molecular Weight : 21.600kDa inclusive of tags
Tissue specificity : Brain. Down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells (at protein level).
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 2.4% Urea
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMDRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHVNPQEKRLAADDPEVRVLHSIGHS
Sequence Similarities : Belongs to the ephrin family.
Gene Name EFNA1 ephrin-A1 [ Homo sapiens ]
Official Symbol EFNA1
Synonyms EFNA1; ephrin-A1; EPLG1, TNFAIP4; ECKLG; LERK1;
Gene ID 1942
mRNA Refseq NM_182685
Protein Refseq NP_872626
MIM 191164
Uniprot ID P20827
Chromosome Location 1q21-q22
Pathway Arf6 signaling events, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; EPHA forward signaling, organism-specific biosystem; EPHA2 forward signaling, organism-specific biosystem;
Function ephrin receptor binding; protein binding; receptor binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EFNA1 Products

Required fields are marked with *

My Review for All EFNA1 Products

Required fields are marked with *

0
cart-icon