"EFNA1" Related Products

Expand
Expand

Recombinant Human EFNA1, His-tagged

Cat.No.: EFNA1-28470TH
Product Overview: Recombinant full length Human Ephrin A1 with an N terminal His tag; 185 amino acids with tag, Predicted MWt 21.6 kDa.
Description: This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis.
Protein length: 164 amino acids
Conjugation: HIS
Molecular Weight: 21.600kDa inclusive of tags
Source: E. coli
Tissue specificity: Brain. Down-regulated in primary glioma tissues compared to the normal tissues. The soluble monomeric form is expressed in the glioblastoma multiforme (GBM) and breast cancer cells (at protein level).
Form: Liquid
Purity: >90% by SDS-PAGE
Storage buffer: pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 2.4% Urea
Storage: Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMDRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHVNPQEKRLAADDPEVRVLHSIGHS
Sequence Similarities: Belongs to the ephrin family.
Gene Name: EFNA1 ephrin-A1 [ Homo sapiens ]
Official Symbol: EFNA1
Synonyms: EFNA1; ephrin-A1; EPLG1, TNFAIP4; ECKLG; LERK1;
Gene ID: 1942
mRNA Refseq: NM_182685
Protein Refseq: NP_872626
MIM: 191164
Uniprot ID: P20827
Chromosome Location: 1q21-q22
Pathway: Arf6 signaling events, organism-specific biosystem; Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; EPHA forward signaling, organism-specific biosystem; EPHA2 forward signaling, organism-specific biosystem;
Function: ephrin receptor binding; protein binding; receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.