Recombinant Human EFNA1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | EFNA1-1561H |
Product Overview : | EFNA1 MS Standard C13 and N15-labeled recombinant protein (NP_004419) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin which binds to the EPHA2, EPHA4, EPHA5, EPHA6, and EPHA7 receptors. Two transcript variants that encode different isoforms were identified through sequence analysis. |
Molecular Mass : | 23.8 kDa |
AA Sequence : | MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHSAAPRLFPLAWTVLLLPLLLLQTPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | EFNA1 ephrin-A1 [ Homo sapiens (human) ] |
Official Symbol | EFNA1 |
Synonyms | EFNA1; ephrin-A1; EPLG1, TNFAIP4; ECKLG; LERK1; TNF alpha-induced protein 4; ligand of eph-related kinase 1; immediate early response protein B61; eph-related receptor tyrosine kinase ligand 1; tumor necrosis factor alpha-induced protein 4; tumor necrosis factor, alpha-induced protein 4; B61; EFL1; EPLG1; LERK-1; TNFAIP4; |
Gene ID | 1942 |
mRNA Refseq | NM_004428 |
Protein Refseq | NP_004419 |
MIM | 191164 |
UniProt ID | P20827 |
◆ Recombinant Proteins | ||
EFNA1-28470TH | Recombinant Human EFNA1, His-tagged | +Inquiry |
Efna1-3314M | Active Recombinant Mouse Efna1 protein(Met1-Ser182), His-tagged | +Inquiry |
EFNA1-1382M | Recombinant Mouse EFNA1 Protein, Fc/His-tagged | +Inquiry |
EFNA1-3265H | Recombinant Human EFNA1 Protein (Asp19-Ser182), C-His tagged | +Inquiry |
EFNA1-4215HF | Recombinant Full Length Human EFNA1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EFNA1-1514RCL | Recombinant Rat EFNA1 cell lysate | +Inquiry |
EFNA1-2177MCL | Recombinant Mouse EFNA1 cell lysate | +Inquiry |
EFNA1-2594HCL | Recombinant Human EFNA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EFNA1 Products
Required fields are marked with *
My Review for All EFNA1 Products
Required fields are marked with *