Recombinant Human EGR1 EGR1-28467TH

Cat.No.:	EGR1-28467TH
Product Overview:	Recombinant fragment correponding to amino acids 444-543 of Human Egr1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Description:	The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene.
Protein length:	100 amino acids
Molecular Weight:	36.630kDa inclusive of tags
Source:	Wheat germ
Form:	Liquid
Purity:	Proprietary Purification
Storage buffer:	pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage:	Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids:	SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Sequence Similarities:	Belongs to the EGR C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.

Download Datasheet

Gene Name:	EGR1 early growth response 1 [ Homo sapiens ]
Official Symbol:	EGR1
Synonyms:	EGR1; early growth response 1; early growth response protein 1; AT225; G0S30; KROX 24; nerve growth factor induced protein A; NGFI A; TIS8; transcription factor ETR103; ZIF 268; zinc finger protein 225; ZNF225;
Gene ID:	1958
mRNA Refseq:	NM_001964
Protein Refseq:	NP_001955
MIM:	128990
Uniprot ID:	P18146
Chromosome Location:	5q23-q31
Pathway:	Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem;
Function:	DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity; double-stranded DNA binding; histone acetyltransferase binding; metal ion binding;