"EGR1" Related Products

Expand
Expand
Expand

Recombinant Human EGR1

Cat.No.: EGR1-28467TH
Product Overview: Recombinant fragment correponding to amino acids 444-543 of Human Egr1 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.
Description: The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC
Sequence Similarities: Belongs to the EGR C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.
Gene Name: EGR1 early growth response 1 [ Homo sapiens ]
Official Symbol: EGR1
Synonyms: EGR1; early growth response 1; early growth response protein 1; AT225; G0S30; KROX 24; nerve growth factor induced protein A; NGFI A; TIS8; transcription factor ETR103; ZIF 268; zinc finger protein 225; ZNF225;
Gene ID: 1958
mRNA Refseq: NM_001964
Protein Refseq: NP_001955
MIM: 128990
Uniprot ID: P18146
Chromosome Location: 5q23-q31
Pathway: Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Downstream signaling in naive CD8+ T cells, organism-specific biosystem; ErbB1 downstream signaling, organism-specific biosystem; Glucocorticoid receptor regulatory network, organism-specific biosystem;
Function: DNA binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity; double-stranded DNA binding; histone acetyltransferase binding; metal ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.