"EGR2" Related Products

Expand
Expand
Expand

Recombinant Human EGR2

Cat.No.: EGR2-28469TH
Product Overview: Recombinant fragment corresponding to amino acids 217-293 of Human EGR2 with an N terminal proprietary tag; Predicted MWt 34.10 kDa.
Description: The protein encoded by this gene is a transcription factor with three tandem C2H2-type zinc fingers. Defects in this gene are associated with Charcot-Marie-Tooth disease type 1D (CMT1D), Charcot-Marie-Tooth disease type 4E (CMT4E), and with Dejerine-Sottas syndrome (DSS). Multiple transcript variants encoding two different isoforms have been found for this gene.
Protein length: 77 amino acids
Molecular Weight: 34.100kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: PGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPR
Sequence Similarities: Belongs to the EGR C2H2-type zinc-finger protein family.Contains 3 C2H2-type zinc fingers.
Gene Name: EGR2 early growth response 2 [ Homo sapiens ]
Official Symbol: EGR2
Synonyms: EGR2; early growth response 2; early growth response 2 (Krox 20 homolog, Drosophila) , KROX20; early growth response protein 2; Krox 20 homolog; Drosophila;
Gene ID: 1959
mRNA Refseq: NM_001136178
Protein Refseq: NP_001129650
MIM: 129010
Uniprot ID: P11161
Chromosome Location: 10q21.1
Pathway: Adipogenesis, organism-specific biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; Developmental Biology, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem;
Function: DNA binding; RNA polymerase II activating transcription factor binding; chromatin binding; metal ion binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.