"EIF4B" Related Products

Recombinant Human EIF4B

Cat.No.: EIF4B-27411TH
Product Overview: Recombinant full length Human eIF4B with a N terminal proprietary tag: predicted molecular weight 93.28 kDa inclusive of tag.
Description: eIF4B is required for the binding of mRNA to ribosomes. It functions in close association with eIF4F and eIF4A. It binds near the 5-terminal cap of mRNA in the presence of eIF4F and ATP.
Protein length: 611 amino acids
Molecular Weight: 93.280kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSW ADETDDLEGDVSTTWHSNDDDVYRAPPIDRSILPTAPRAA REPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLN ISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEES LGNRRIRVDVADQAQDKDRDDRSFGRDRNRDSDKTDTDWR ARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDG YRDGPCRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRA FGSGYRRDDDYRGGGDRYEDRYDRRDDRSWSSRDDYSRDD YRRDDRGPPQRPKLNLKPRSTPKEDDSSASTSQSTRAASI FGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRP RERHPSWRSEETQERERSRTGSESSQTGTSTTSSRNARRR ESEKSLENETLNKEEDCHSPTSKPPKPDQPLKVMPAPPPK ENAWVKRSSNPPARSQSSDTEQQSPTSGGGKVAPAQPSEE GPGRKDENKVDGMNAPKGQTGNSSRGPGDGGNRDHWKESD RKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDG EDENEGEDYAE
Gene Name: EIF4B eukaryotic translation initiation factor 4B [ Homo sapiens ]
Official Symbol: EIF4B
Synonyms: EIF4B; eukaryotic translation initiation factor 4B;
Gene ID: 1975
mRNA Refseq: NM_001417
Protein Refseq: NP_001408
MIM: 603928
Uniprot ID: P23588
Chromosome Location: 12q13.13
Pathway: Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S, organism-specific biosystem; Cap-dependent Translation Initiation, organism-specific biosystem; Deadenylation of mRNA, organism-specific biosystem; Deadenylation-dependent mRNA decay, organism-specific biosystem; Eukaryotic Translation Initiation, organism-specific biosystem;
Function: RNA binding; nucleotide binding; translation initiation factor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.