"EIF4G1" Related Products

Expand

Recombinant Human EIF4G1, GST-tagged

Cat.No.: EIF4G1-28550TH
Product Overview: Recombinant Human EIF4G1(1500 a.a. - 1599 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: The protein encoded by this gene is a component of the multi-subunit protein complex EIF4F. This complex facilitates the recruitment of mRNA to the ribosome, which is a rate-limiting step during the initiation phase of protein synthesis. The recognition of the mRNA cap and the ATP-dependent unwinding of 5'-terminal secondary structure is catalyzed by factors in this complex. The subunit encoded by this gene is a large scaffolding protein that contains binding sites for other members of the EIF4F complex. A domain at its N-terminus can also interact with the poly(A)-binding protein, which may mediate the circularization of mRNA during translation. Alternative splicing results in multiple transcript variants, some of which are derived from alternative promoter usage.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 36.74 kDa
AA Sequence: DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQG KGVALKSVTAFFKWLREAEEESDHN
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: EIF4G1 eukaryotic translation initiation factor 4 gamma, 1 [ Homo sapiens (human) ]
Official Symbol: EIF4G1
Synonyms: EIF4G1; eukaryotic translation initiation factor 4 gamma, 1; P220; EIF4F; EIF4G; EIF4GI; PARK18; EIF-4G1; eukaryotic translation initiation factor 4 gamma 1; EIF4-gamma; eIF-4-gamma 1; eucaryotic translation initiation factor 4G
Gene ID: 1981
mRNA Refseq: NM_182917
Protein Refseq: NP_886553
MIM: 600495
UniProt ID: Q04637
Chromosome Location: 3q27.1
Pathway: AUF1 (hnRNP D0) destabilizes mRNA; Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S; Antiviral mechanism by IFN-stimulated genes
Function: poly(A) RNA binding; protein binding; translation factor activity, nucleic acid binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.