"ELAVL4" Related Products

Expand
Expand
Expand

Recombinant Human ELAVL4

Cat.No.: ELAVL4-27181TH
Product Overview: Recombinant fragment of Human ELAVL4 with an N terminal proprietary tag. Predicted MW 33.22kDa.
Description: HuD otherwise known as ELAV-like protein 4 is a protein that in humans is encoded by the ELAVL4 gene. The HuD/ELAVL4 protein is an RNA-binding protein. HuD is expressed only in neurons and it binds to AU-rich element-containing mRNAs.
Protein length: 69 amino acids
Molecular Weight: 33.220kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Brain.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
Sequence Similarities: Belongs to the RRM elav family.Contains 3 RRM (RNA recognition motif) domains.
Gene Name: ELAVL4 ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) [ Homo sapiens ]
Official Symbol: ELAVL4
Synonyms: ELAVL4; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D); HUD; ELAV-like protein 4; PNEM;
Gene ID: 1996
mRNA Refseq: NM_001144774
Protein Refseq: NP_001138246
MIM: 168360
Uniprot ID: P26378
Chromosome Location: 1p34
Function: AU-rich element binding; RNA binding; mRNA 3-UTR binding; nucleotide binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.