Recombinant Human ELAVL4 Protein, GST-tagged

Cat.No. : ELAVL4-3235H
Product Overview : Human ELAVL4 partial ORF ( NP_068771, 312 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ELAVL4 (ELAV Like RNA Binding Protein 4) is a Protein Coding gene. Diseases associated with ELAVL4 include Hallucinogen Abuse and Paraneoplastic Neurologic Disorders. GO annotations related to this gene include nucleic acid binding and nucleotide binding. An important paralog of this gene is ELAVL2.
Molecular Mass : 33.33 kDa
AA Sequence : VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ELAVL4 ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) [ Homo sapiens ]
Official Symbol ELAVL4
Synonyms ELAVL4; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D); HUD; ELAV-like protein 4; PNEM; hu-antigen D; paraneoplastic encephalomyelitis antigen HuD; Embryonic lethal, abnormal vision, Drosophila, homolog of, like-4;
Gene ID 1996
mRNA Refseq NM_001144774
Protein Refseq NP_001138246
MIM 168360
UniProt ID P26378

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELAVL4 Products

Required fields are marked with *

My Review for All ELAVL4 Products

Required fields are marked with *

0
cart-icon
0
compare icon