Recombinant Human ELAVL4 Protein, GST-tagged
Cat.No. : | ELAVL4-3235H |
Product Overview : | Human ELAVL4 partial ORF ( NP_068771, 312 a.a. - 380 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ELAVL4 (ELAV Like RNA Binding Protein 4) is a Protein Coding gene. Diseases associated with ELAVL4 include Hallucinogen Abuse and Paraneoplastic Neurologic Disorders. GO annotations related to this gene include nucleic acid binding and nucleotide binding. An important paralog of this gene is ELAVL2. |
Molecular Mass : | 33.33 kDa |
AA Sequence : | VLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDEAAMAIASLNGYRLGDRVLQVSFKTNKAHKS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ELAVL4 ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) [ Homo sapiens ] |
Official Symbol | ELAVL4 |
Synonyms | ELAVL4; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D); HUD; ELAV-like protein 4; PNEM; hu-antigen D; paraneoplastic encephalomyelitis antigen HuD; Embryonic lethal, abnormal vision, Drosophila, homolog of, like-4; |
Gene ID | 1996 |
mRNA Refseq | NM_001144774 |
Protein Refseq | NP_001138246 |
MIM | 168360 |
UniProt ID | P26378 |
◆ Recombinant Proteins | ||
ELAVL4-27181TH | Recombinant Human ELAVL4 | +Inquiry |
ELAVL4-3660H | Recombinant Human ELAVL4 protein, GST-tagged | +Inquiry |
ELAVL4-9021Z | Recombinant Zebrafish ELAVL4 | +Inquiry |
ELAVL4-2185H | Recombinant Human ELAVL4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ELAVL4-197HFL | Active Recombinant Full Length Human ELAVL4 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELAVL4-6635HCL | Recombinant Human ELAVL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELAVL4 Products
Required fields are marked with *
My Review for All ELAVL4 Products
Required fields are marked with *
0
Inquiry Basket