"ELK3" Related Products

Expand

Recombinant Human ELK3

Cat.No.: ELK3-28287TH
Product Overview: Recombinant fragment of Human ELK3 with N-terminal proprietary tag. Predicted MW 36.63kDa.
Description: The protein encoded by this gene is a member of the ETS-domain transcription factor family and the ternary complex factor (TCF) subfamily. Proteins in this subfamily regulate transcription when recruited by serum response factor to bind to serum response elements. This protein is activated by signal-induced phosphorylation; studies in rodents suggest that it is a transcriptional inhibitor in the absence of Ras, but activates transcription when Ras is present.
Protein length: 100 amino acids
Molecular Weight: 36.630kDa inclusive of tags
Source: Wheat germ
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: SRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVS
Sequence Similarities: Belongs to the ETS family.Contains 1 ETS DNA-binding domain.
Gene Name: ELK3 ELK3, ETS-domain protein (SRF accessory protein 2) [ Homo sapiens ]
Official Symbol: ELK3
Synonyms: ELK3; ELK3, ETS-domain protein (SRF accessory protein 2); ETS domain-containing protein Elk-3; ERP; NET; SAP2;
Gene ID: 2004
mRNA Refseq: NM_005230
Protein Refseq: NP_005221
MIM: 600247
Uniprot ID: P41970
Chromosome Location: 12q23
Pathway: Id Signaling Pathway, organism-specific biosystem;
Function: protein binding; purine-rich negative regulatory element binding; sequence-specific DNA binding transcription factor activity; transcription corepressor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.