Recombinant Human ELK3

Cat.No. : ELK3-28287TH
Product Overview : Recombinant fragment of Human ELK3 with N-terminal proprietary tag. Predicted MW 36.63kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 100 amino acids
Description : The protein encoded by this gene is a member of the ETS-domain transcription factor family and the ternary complex factor (TCF) subfamily. Proteins in this subfamily regulate transcription when recruited by serum response factor to bind to serum response elements. This protein is activated by signal-induced phosphorylation; studies in rodents suggest that it is a transcriptional inhibitor in the absence of Ras, but activates transcription when Ras is present.
Molecular Weight : 36.630kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVS
Sequence Similarities : Belongs to the ETS family.Contains 1 ETS DNA-binding domain.
Gene Name ELK3 ELK3, ETS-domain protein (SRF accessory protein 2) [ Homo sapiens ]
Official Symbol ELK3
Synonyms ELK3; ELK3, ETS-domain protein (SRF accessory protein 2); ETS domain-containing protein Elk-3; ERP; NET; SAP2;
Gene ID 2004
mRNA Refseq NM_005230
Protein Refseq NP_005221
MIM 600247
Uniprot ID P41970
Chromosome Location 12q23
Pathway Id Signaling Pathway, organism-specific biosystem;
Function protein binding; purine-rich negative regulatory element binding; sequence-specific DNA binding transcription factor activity; transcription corepressor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ELK3 Products

Required fields are marked with *

My Review for All ELK3 Products

Required fields are marked with *

0
cart-icon