Recombinant Human ELK3
Cat.No. : | ELK3-28287TH |
Product Overview : | Recombinant fragment of Human ELK3 with N-terminal proprietary tag. Predicted MW 36.63kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | The protein encoded by this gene is a member of the ETS-domain transcription factor family and the ternary complex factor (TCF) subfamily. Proteins in this subfamily regulate transcription when recruited by serum response factor to bind to serum response elements. This protein is activated by signal-induced phosphorylation; studies in rodents suggest that it is a transcriptional inhibitor in the absence of Ras, but activates transcription when Ras is present. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SRESLLLQDSDCKASPEGREAHKHGLAALRSTSRNEYIHSGLYSSFTINSLQNPPDAFKAIKTEKLEEPPEDSPPVEEVRTVIRFVTNKTDKHVTRPVVS |
Sequence Similarities : | Belongs to the ETS family.Contains 1 ETS DNA-binding domain. |
Gene Name | ELK3 ELK3, ETS-domain protein (SRF accessory protein 2) [ Homo sapiens ] |
Official Symbol | ELK3 |
Synonyms | ELK3; ELK3, ETS-domain protein (SRF accessory protein 2); ETS domain-containing protein Elk-3; ERP; NET; SAP2; |
Gene ID | 2004 |
mRNA Refseq | NM_005230 |
Protein Refseq | NP_005221 |
MIM | 600247 |
Uniprot ID | P41970 |
Chromosome Location | 12q23 |
Pathway | Id Signaling Pathway, organism-specific biosystem; |
Function | protein binding; purine-rich negative regulatory element binding; sequence-specific DNA binding transcription factor activity; transcription corepressor activity; |
◆ Recombinant Proteins | ||
ELK3-3237Z | Recombinant Zebrafish ELK3 | +Inquiry |
ELK3-4709H | Recombinant Human ELK3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ELK3-5135M | Recombinant Mouse ELK3 Protein | +Inquiry |
ELK3-28287TH | Recombinant Human ELK3 | +Inquiry |
ELK3-3244H | Recombinant Human ELK3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ELK3-6629HCL | Recombinant Human ELK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ELK3 Products
Required fields are marked with *
My Review for All ELK3 Products
Required fields are marked with *