"EML1" Related Products

Expand

Recombinant Human EML1

Cat.No.: EML1-28291TH
Product Overview: Recombinant full length Human EML1 with N terminal proprietary tag; Predicted MW 115.76 kDa.
Description: Human echinoderm microtubule-associated protein-like is a strong candidate for the Usher syndrome type 1A gene. Usher syndromes (USHs) are a group of genetic disorders consisting of congenital deafness, retinitis pigmentosa, and vestibular dysfunction of variable onset and severity depending on the genetic type. The disease process in USHs involves the entire brain and is not limited to the posterior fossa or auditory and visual systems. The USHs are catagorized as type I (USH1A, USH1B, USH1C, USH1D, USH1E and USH1F), type II (USH2A and USH2B) and type III (USH3). The type I is the most severe form. Gene loci responsible for these three types are all mapped. Two transcript variants encoding different isoforms have been found for this gene.
Protein length: 815 amino acids
Molecular Weight: 115.760kDa inclusive of tags
Source: Wheat germ
Tissue specificity: Ubiquitous; expressed in most tissues with the exception of thymus and peripheral blood lymphocytes.
Form: Liquid
Purity: Proprietary Purification
Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: MEDGFSSYSSLYDTSSLLQFCNDDSASAASSMEVTDRIAS LEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKG PTKARPLMQTLPLRTTVNNGTVLPKKPTGSLPSPSGVRKE TAVPATKSNIKRTSSSERVSPGGRRESNGDSRGNRNRTGS TSSSSSGKKNSESKPKEPVFSAEEGYVKMFLRGRPVTMYM PKDQVDSYSLEAKVELPTKRLKLEWVYGYRGRDCRNNLYL LPTGETVYFIASVVVLYNVEEQLQRHYAGHNDDVKCLAVH PDRITIATGQVAGTSKDGKQLPPHVRIWDSVTLNTLHVIG IGFFDRAVTCIAFSKSNGGTNLCAVDDSNDHVLSVWDWQK EEKLADVKCSNEAVFAADFHPTDTNIIVTCGKSHLYFWTL EGSSLNKKQGLFEKQEKPKFVLCVTFSENGDTITGDSSGN ILVWGKGTNRISYAVQGAHEGGIFALCMLRDGTLVSGGGK DRKLISWSGNYQKLRKTEIPEQFGPIRTVAEGKGDVILIG TTRNFVLQGTLSGDFTPITQGHTDELWGLAINASKSQFLT CGHDKHATLWDAVGHRPVWDKIIEDPAQSSGFHPSGSVVA VGTLTGRWFVFDTGTKDLVTVHTDGNEQLSVMRYSPDGNF LAIGSHDNCIYIYGVSDNGRKYTRVGKCSGHSSFITHLDW SVNSQFLVSNSGDYEILYWVPSACKQVVSVETTRDIEWAT YTCTLGFHVFGVWPEGSDGTDINAVCRAHEKKLLSTGDDF GKVHLFSYPCSQFRAPSHIYGGHSSHVTNVDFLCEDSHLI STGGKDTSIMQWRVI
Sequence Similarities: Belongs to the WD repeat EMAP family.Contains 10 WD repeats.
Gene Name: EML1 echinoderm microtubule associated protein like 1 [ Homo sapiens ]
Official Symbol: EML1
Synonyms: EML1; echinoderm microtubule associated protein like 1; EMAPL; echinoderm microtubule-associated protein-like 1; ELP79; EMAP; HuEMAP;
Gene ID: 2009
mRNA Refseq: NM_001008707
Protein Refseq: NP_001008707
MIM: 602033
Uniprot ID: O00423
Chromosome Location: 14q32
Function: calcium ion binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.