Recombinant Human EML2, His-tagged EML2-28292TH

Recombinant Human EML2, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human EML2, His-tagged

Recombinant Human EML2, His-tagged

EML2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : EML2-28292TH
Product Overview : Recombinant fragment, corresponding to amino acids 236-470 of Human EML2 with an N terminal His tag. Observed mwt: 27 kDa ;
Conjugation : HIS
Source : E. coli
Tissue specificity : Ubiquitous.
Form : Lyophilised:Reconstitute with 87 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNL YVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGG RDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQ FVTCGQDKLVHLWSSDSHQPLWSRIIEDPARSAGFHPS GSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFS P
Sequence Similarities : Belongs to the WD repeat EMAP family.Contains 11 WD repeats.
Gene Name : EML2 echinoderm microtubule associated protein like 2 [ Homo sapiens ]
Official Symbol : EML2
Synonyms : EML2; echinoderm microtubule associated protein like 2; echinoderm microtubule-associated protein-like 2; echinoderm MT associated protein (EMAP) like protein 70; ELP70; EMAP 2; EMAP2; microtubule associated protein like echinoderm EMAP;
Gene ID : 24139
mRNA Refseq : NM_001193268
Protein Refseq : NP_001180197
Uniprot ID : O95834
Chromosome Location : 19q13.32
Function : catalytic activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy