Recombinant Human EML2, His-tagged
Cat.No. : | EML2-28292TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 236-470 of Human EML2 with an N terminal His tag. Observed mwt: 27 kDa ; |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 236-470 a.a. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitous. |
Form : | Lyophilised:Reconstitute with 87 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNL YVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGG RDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQ FVTCGQDKLVHLWSSDSHQPLWSRIIEDPARSAGFHPS GSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFS P |
Sequence Similarities : | Belongs to the WD repeat EMAP family.Contains 11 WD repeats. |
Gene Name | EML2 echinoderm microtubule associated protein like 2 [ Homo sapiens ] |
Official Symbol | EML2 |
Synonyms | EML2; echinoderm microtubule associated protein like 2; echinoderm microtubule-associated protein-like 2; echinoderm MT associated protein (EMAP) like protein 70; ELP70; EMAP 2; EMAP2; microtubule associated protein like echinoderm EMAP; |
Gene ID | 24139 |
mRNA Refseq | NM_001193268 |
Protein Refseq | NP_001180197 |
Uniprot ID | O95834 |
Chromosome Location | 19q13.32 |
Function | catalytic activity; |
◆ Recombinant Proteins | ||
EML2-481H | Recombinant Human EML2 Protein (1-418 aa), His-SUMO-tagged | +Inquiry |
EML2-3323Z | Recombinant Zebrafish EML2 | +Inquiry |
Eml2-1554R | Recombinant Rat Eml2 protein, His & T7-tagged | +Inquiry |
EML2-2880H | Recombinant Human EML2 Protein (Gly375-Val649), N-His tagged | +Inquiry |
EML2-5180M | Recombinant Mouse EML2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
EML2-247HCL | Recombinant Human EML2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EML2 Products
Required fields are marked with *
My Review for All EML2 Products
Required fields are marked with *