Recombinant Human EML2, His-tagged
| Cat.No. : | EML2-28292TH | 
| Product Overview : | Recombinant fragment, corresponding to amino acids 236-470 of Human EML2 with an N terminal His tag. Observed mwt: 27 kDa ; | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 236-470 a.a. | 
| Conjugation : | HIS | 
| Tissue specificity : | Ubiquitous. | 
| Form : | Lyophilised:Reconstitute with 87 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | GGSLSKRQGLFEKHEKPKYVLCVTFLEGGDVVTGDSGGNL YVWGKGGNRITQAVLGAHDGGVFGLCALRDGTLVSGGG RDRRVVLWGSDYSKLQEVEVPEDFGPVRTVAEGHGDTLYVGTTRNSILQGSVHTGFSLLVQGHVEELWGLATHPSRAQ FVTCGQDKLVHLWSSDSHQPLWSRIIEDPARSAGFHPS GSVLAVGTVTGRWLLLDTETHDLVAIHTDGNEQISVVSFS P | 
| Sequence Similarities : | Belongs to the WD repeat EMAP family.Contains 11 WD repeats. | 
| Gene Name | EML2 echinoderm microtubule associated protein like 2 [ Homo sapiens ] | 
| Official Symbol | EML2 | 
| Synonyms | EML2; echinoderm microtubule associated protein like 2; echinoderm microtubule-associated protein-like 2; echinoderm MT associated protein (EMAP) like protein 70; ELP70; EMAP 2; EMAP2; microtubule associated protein like echinoderm EMAP; | 
| Gene ID | 24139 | 
| mRNA Refseq | NM_001193268 | 
| Protein Refseq | NP_001180197 | 
| Uniprot ID | O95834 | 
| Chromosome Location | 19q13.32 | 
| Function | catalytic activity; | 
| ◆ Recombinant Proteins | ||
| EML2-481H | Recombinant Human EML2 Protein (1-418 aa), His-SUMO-tagged | +Inquiry | 
| EML2-3323Z | Recombinant Zebrafish EML2 | +Inquiry | 
| Eml2-1554R | Recombinant Rat Eml2 protein, His & T7-tagged | +Inquiry | 
| EML2-2880H | Recombinant Human EML2 Protein (Gly375-Val649), N-His tagged | +Inquiry | 
| EML2-5180M | Recombinant Mouse EML2 Protein | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| EML2-247HCL | Recombinant Human EML2 lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All EML2 Products
Required fields are marked with *
My Review for All EML2 Products
Required fields are marked with *
  
        
    
      
            