"ENC1" Related Products

Expand
Expand

Recombinant Human ENC1, His-tagged

Cat.No.: ENC1-28558TH
Product Overview: Recombinant fragment, corresponding to amino acids 261-582 of Human ENC1 with N terminal His tag; 322 amino acids, 37kDa.
Description: DNA damage and/or hyperproliferative signals activate wildtype p53 tumor suppressor protein (TP53; MIM 191170), inducing cell cycle arrest or apoptosis. Mutations that inactivate p53 occur in 50% of all tumors. Polyak et al.
Conjugation: HIS
Source: E. coli
Tissue specificity: Detected in fetal brain tissue, moderate expression in fetal heart, lung and kidney. Highly expressed in adult brain, particularly high in the hippocampus and amygdala, and spinal chord. Detectable in adult pancreas.
Form: Lyophilised:Reconstitute with 117 μl aqua dest.
Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids: KSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLL GGQTFMCDKLYLVDQKAKEIIPKADIPSPRKEFSACAI GCKVYITGGRGSENGVSKDVWVYDTLHEEWSKAAPMLV ARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEH YDPTINKWTMVAPLREGVSNAAVVSAKLKLFAFGGTSV SHDKLPKVQCYDQCENRWTVPATCPQPWRYTAAAVLGN QIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMS CHAVASGNKLYVVGGYFGIQRCKTLDCYDPTLDVWNSITT VPYSLIPTAFVS
Sequence Similarities: Contains 1 BTB (POZ) domain.Contains 6 Kelch repeats.
Gene Name: ENC1 ectodermal-neural cortex 1 (with BTB-like domain) [ Homo sapiens ]
Official Symbol: ENC1
Synonyms: ENC1; ectodermal-neural cortex 1 (with BTB-like domain); NRPB; ectoderm-neural cortex protein 1; ENC 1; kelch like 37 (Drosophila); KLHL37; PIG10; TP53I10;
Gene ID: 8507
mRNA Refseq: NM_003633
Protein Refseq: NP_003624
MIM: 605173
Uniprot ID: O14682
Chromosome Location: 5q13
Function: actin binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.